Change search
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Cascaded counter-propagating nonlinear interactions inhighly-efficient sub-μm periodically poled crystals
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0002-8091-195x
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0002-4452-0759
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics. KTH, School of Engineering Sciences (SCI), Physics.
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics. KTH, School of Engineering Sciences (SCI), Physics.ORCID iD: 0000-0002-2508-391X
Show others and affiliations
2017 (English)In: Scientific Reports, ISSN 2045-2322, E-ISSN 2045-2322, Vol. 8, article id 8037Article in journal (Refereed) Published
Abstract [en]

Mirrorless optical parametric oscillators (MOPOs) are very attractive parametric devices that rely on the nonlinear interaction of counter-propagating photons to inherently establish distributed feedback, without the use of external mirrors or surface coatings. These devices offer unique spectral and coherence properties that will benefit a large variety of applications ranging from spectroscopy to quantum communications. The major obstacle in exploiting their full potential is ascribed to the difficulty in engineering a nonlinear material in which the generation of counter-propagating waves can be phase matched. Here we present a reliable and consistent technique for fabrication of highly-efficient sub-micrometer periodically poled Rb-doped KTiOPO4. We experimentally demonstrate the first cascaded counter-propagating interactions in which the generated forward signal serves as a pump for a secondary MOPO process, reaching pump depletion larger than 60%. The cascaded process exemplifies the high efficiency of our nonlinear photonic structures. Our domain-engineering technique paves the way to realize counter-propagating schemes and devices that have been deemed unfeasible until now.

Place, publisher, year, edition, pages
Nature Publishing Group, 2017. Vol. 8, article id 8037
National Category
Atom and Molecular Physics and Optics
Identifiers
URN: urn:nbn:se:kth:diva-207158DOI: 10.1038/s41598-017-07016-yISI: 000407559800004PubMedID: 28808234OAI: oai:DiVA.org:kth-207158DiVA, id: diva2:1096454
Note

QC 20170602

Available from: 2017-05-17 Created: 2017-05-17 Last updated: 2019-05-14Bibliographically approved
In thesis
1. Advanced nano- and microdomain engineering of Rb-doped KTiOPO4 for nonlinear optical applications
Open this publication in new window or tab >>Advanced nano- and microdomain engineering of Rb-doped KTiOPO4 for nonlinear optical applications
2017 (English)Doctoral thesis, comprehensive summary (Other academic)
Abstract [en]

Fine-pitch ferroelectric domain gratings are extensively used for generation of light in the visible and near-infrared spectral regions through quasi-phase matched (QPM) frequency conversion. Sub-μm QPM devices enables demonstration of nonlinear optics with counterpropagating waves, a field of nonlinear optics which remains sparsely explored due to the difficulty of fabricatinghigh quality gratings.

In recent years, bulk Rb-doped KTiOPO4 (RKTP) has emerged as a highly promising nonlinear materials for fabrication of fine-pitch QPM devices through periodic electric-field poling. RKTP possesses large optical nonlinearity and high resistance to optical damage, while demonstrating improved material homogeneity and lower ionic conductivity than its isomorphs, which are important features for poling. Although fine-pitch QPM gratings, as well as large aperture QPM devices, have been demonstrated, fabrication of sub-μm high quality QPM devices remains a challenge.

The primary aim of this research was to develop a reliable method to fabricate high-quality sub-μm periodically poled RKTP crystals (PPRKTP) and exploit them in novel optical applications. For this purpose, a novel poling method was developed. It was based on periodic modulation of the coercive field through ion exchange, where K+ ions are exchanged with Rb+ in the crystal, to modulate the coercive field and the ionic conductivity. This enables periodic poling of higher quality and with shorter period than ever before.

High quality PPRKTP with a period of 755 nm were fabricated and used to demonstrate the first cascaded mirrorless optical parametric oscillator (MOPO), as well as the first MOPO pumped by a Q-switched laser. PPRKTP samples for blue light generation were fabricated, and second harmonic generation (SHG) was investigated with a high power 946 nm fiber laser. Up to 2 W of blue power was demonstrated for bulk samples, where the output power was limited by absorption of the SHG, leading to thermal dephasing of the devices. Laser-written waveguides were fabricated in PPRKTP for the first time, and a record high SHG power of 76 mW was obtained.

Finally, the high-temperature stability of ferroelectric domain gratings was investigated. This is of utmost importance when a PPRKTP crystal is used as a seed for crystal growth. It was found that for charged domains walls, the domain-wall motion was highly anisotropic with rapid movement in y-direction while only small movements were observed in the x-direction of the crystal.

Abstract [sv]

Ickelinjära ferroelektriska kristaller med artificiella domängitter med perioder av några mikrometer används idag för generering av ljus i de synliga och nära-infraröda våglängdsområdena, genom kvasifasmatchad (QPM) frekvenskonvertering. Med sub-μm QPM domängitter kan man åstadkomma ickelinjära optiska effekter med motpropagerande parametriska ljusvågor. Detta är ett område av den ickelinjära optiken som fortfarande är tämligen outforskat på grund av svårigheten med att tillverka högkvalitativa domängitter.

 Under de senaste åren har Rb-dopat KTiOPO4 (RKTP) blivit ett mycket lovande ickelinjärt material för tillverkning av QPM-gitter med mycket korta perioder genom periodisk elektrisk fält polning. RKTP kristallen har en hög optisk ickelinejäritet och den tål höga optiska intensiteter, samtidigt som materialet har bättre materialhomogenitet och lägre jonledningsförmåga än vad dess isomorfa kristaller har. De två senare egenskaperna har visat sig viktiga för att få en lyckad polning. Fastän QPM-gitter med kort periodicitet, liksom QPM-gitter med stor apertur, har demonstrerats, är tillverkningen av högkvalitativa QPM-kristaller med sub-µm perioder fortfarande en utmaning.

Det primära syftet med denna avhandling var att utveckla en pålitlig metod för att tillverka högkvalitativa sub-μm periodiskt polade RKTP kristaller (PPRKTP) och utnyttja dem i nya optiska tillämpningar. I detta syfte utvecklades en ny polningsmetod. Den baseras på periodiskt jonutbyte, där K+ joner byts mot Rb+ i kristallen, vilket resulterar i en samtidig modulation av materialets koerciva fält och jonledningsförmåga. Detta möjliggör i sin tur periodisk polning av högre kvalitet och med kortare perioder än någonsin tidigare har uppnåtts.

Högkvalitativa PPRKTP kristaller med en period på 755 nm tillverkades och användes för att demonstrera den första kaskaderade spegelfria optiska parametriska oscillatorn (MOPO), liksom den första MOPO processen pumpad av en Q-switchad laser. Vidare utvecklades PPRKTP-kristaller för generering av blått ljus via frekvensdubbling. Dessa utvärderades med hjälp av en högeffekts-fiberlaser vid 946 nm. Upp till 2 W av blått ljus erhölls för bulkkristallerna. Uteffekten begränsades av absorption av det blåa frekvensdubblade ljuset, vilket ledde till urfasning i QPM-gittret p.g.a. termiska effekter. Laserskrivna vågledare tillverkades sedan i PPRKTP för första gången, och en rekordhög effekt på 76 mW erhölls via frekvensdubbling.

Slutligen undersöktes stabiliteten hos de periodiskt polade domängitterna vid höga temperaturer. Det är viktigt att domängittrena är stabila när PPRKTP kristallerna används som ympämne för kristalltillväxt. Det visade sig att instabila domänväggar flyttade sig mycket anisotropt, med en snabb rörelse i kristallens y-riktning och en långsam rörelse i kristallens x-riktning.

Place, publisher, year, edition, pages
KTH Royal Institute of Technology, 2017. p. 97
Series
TRITA-FYS, ISSN 0280-316X ; 2017:29
Keywords
KTiOPO4, nonlinear optics, MOPO, quasi-phase matching, SHG, ferroelectrics, domain structuring, periodic poling
National Category
Atom and Molecular Physics and Optics
Research subject
Physics
Identifiers
urn:nbn:se:kth:diva-207161 (URN)978-91-7729-413-9 (ISBN)
Public defence
2017-06-15, FA32, AlbaNova Universitetscentrum, Roslagstullsbacken 21, Stockholm, 09:15 (English)
Opponent
Supervisors
Funder
Swedish Foundation for Strategic Research Swedish Research Council
Note

QC 20170519

Available from: 2017-05-19 Created: 2017-05-17 Last updated: 2017-05-19Bibliographically approved
2. Nonlinear optics in KTiOPO4 for spectral management of ultra-short pulses in the near- and mid-IR
Open this publication in new window or tab >>Nonlinear optics in KTiOPO4 for spectral management of ultra-short pulses in the near- and mid-IR
2019 (English)Doctoral thesis, comprehensive summary (Other academic)
Abstract [en]

This thesis explores the possibilities of controlling nonlinear optical interactions in ferroelectric materials for bandwidth tailoring of ultrashort pulses in the pico- and femto-second range. The control is achieved through quasi-phase matching, which is based on alternating the material’s spontaneous polarization into different domains. In the presented work, KTiOPO4 (KTP) is the material of choice as it provides high optical nonlinearity, a wide transparency window in the near- and mid-infrared (IR), as well as a high damage threshold. Furthermore, KTP also enables fabrication of uniform high aspect ratio and fine-pitch domain structures of high quality. These qualities make KTP highly attractive for a vast range of applications and enabled much of the work presented in this thesis.The propagation of ultrashort pulses in domain-structured ferroelectrics was studied numerically with a model based on a single nonlinear envelope equation. This model accounts for the absorption and the dispersion of the material, as well as the second- and the third-order nonlinearities. Supercontinuum generation in the near- and mid-IR was studied in periodically structured KTP for femtosecond pulses at 1.5 μm. The numerical results showed the potential for pulse self-compression with octave-spanning spectral broadening. This process is enabled by cascaded second-order nonlinearities and can be tailored by the phase-matching parameters, which are set by the structure’s periodicity. The proposed design presented in this work resulted in a negative effective Kerr nonlinear coefficient with a magnitude of 1.65x10-14 cm2/W in the positive dispersion regime, which is one order of magnitude higher than the natural Kerr coefficient in KTP. Experimental characterization of single pass propagation of 128 fs-long pulses at 1.52 μm through a periodically structured KTP sample, with a periodicity of 36 μm based on the proposed design, are also presented. The results show a spectral broadening from 1.1 μm to 2.7 μm and a simultaneous compression down to 18.6 fs, thus confirming the numerical findings. Bandwidth tailoring of ultrashort IR pulses in the picosecond range was also studied through devices known as backward-wave optical parametric oscillators (BWOPOs). These devices rely on sub-micrometer domain periods to generate counter-propagating signal and idler waves. In a BWOPO, the forward-generated wave inherits the phase modulation of the pump wave, while the backward-generated wave is inherently narrowband and basically insensitive to pump wavelength tuning. In this work, BWOPOs operated in a cascaded manner, with the forward-generated wave being employed as a pump in a single pass configuration, were studied. The tunability issue of the narrowband backward wave was solved by employing a broadband optical parametric amplifier seeded by the BWOPO forward wave. A tunability of 2.7 THz for a wave at 1.87 μm with a bandwidth of 28 GHz was demonstrated. The coherent phase transfer from the pump to the BWOPO forward wave was investigated in the context of pulse compression. In this experiment, a 220 GHz bandwidth was transferred from 800 nm to 150 ps-long pulses at 1.4 μm, which could be compressed down to 1.3 ps with μJ energy, in a single-grating compressor.

Abstract [sv]

I den här avhandlingen undersöks möjligheterna att kontrollera ickelinjära optiska processer iferroelektriska material. Detta för att kunna anpassa bandbredden hos ultrakorta pulser i piko- ochfemtosekundsområdena. Processerna kontrolleras genom kvasifasmatchning, vilket innebär attmaterialets spontana polarisation alterneras på ett sätt som ger upphov till olika domäner. Arbetetsom presenteras här avser främst användandet av kristallen KTiOPO4 (KTP), då den har en högoptisk ickelinjäritet, en bred transmission i de nära- och mellan-infraröda områdena samt en högskadetröskel. Dessutom möjliggör KTP tillverkning av uniforma samt finstrukturerade domänermed hög kontrast och kvalitet. Dessa egenskaper gör KTP till ett attraktivt material för en stormängd tillämpningar och har möjliggjort mycket av arbetet i denna avhandling.Utbredning av ultrakorta pulser i domänstrukturerade ferroelektriska material studeradesnumeriskt med en modell som baserades på en ickelinjär amplitudekvation. Modellen tar hänsyntill materialets absorption och dispersion så väl som andra- och tredje ordningens ickelinjäriteter.Superkontinuumgenerering i det nära- och mellan-infraröda området undersöktes för periodisktstrukturerat KTP i fallet med femtosekundspulser vid 1.5 μm. Beräkningarna visade att pulsernakan genomgå självkomprimering i samband med en oktavsträckande spektral breddning. Dessaprocesser möjligörs av kaskaderade andra ordningens ickelinjäriteter och kan anpassas medkvasifasmatchningsparametrarna, vilka bestäms av strukturens periodicitet. Designen sompresenteras i detta arbete gav upphov till en negativ effektiv ickelinjär Kerr-koefficient med enstorlek på 1.651014 cm2/W i det positiva dispersionsområdet, vilket är en storleksordning högreän den naturliga Kerr-koefficienten i KTP. Karaktäriseringen av ett enkelpasseringsexperimentmed en 128 fs-puls vid 1.52 μm propagerandes genom en periodiskt strukturerad KTP-kristall,med en periodicitet på 36 μm, presenteras också. Resultaten visar på en spektral breddning från1.1 μm till 2.7 μm samt en komprimering ner till 18.6 fs, vilket således verifierar de numeriskaresultaten.Möjligheten att anpassa bandbredden för ultrakorta infraröda pulser studerades även ipikosekundsområdet med s.k. baklängesvågs-optiska parametriska oscillatorer (BWOPO). Denhär sortens system bygger på domänstrukturer med sub-mikrometerperioder för att genereramotpropagerande signal- och komplementärsignalvågor. I dessa system får den framåtgenereradevågen samma fasmodulation som pumpvågen, medan den bakåtgenererade vågen är intrinsisktsmalbanding och i stort sett okänslig för ändringar i pumpvåglängden. I detta arbete studeraskaskaderade BWOPO-system, där den framåtgenererade vågen används som pump i enenkelpasseringskonfiguration. Problemet med att ändra våglängden på den smalbandigabakåtpropagerande signalen löstes genom att passera den genom en bredbanding optiskparametrisk förstärkare, vilket möjliggjorde ett frekvensskift på 2.7 THz för en våglängd kring1.87 μm med en bandbredd på 28 GHz. Den koherenta fasöverföringen från pumpen till denframåtpropagerande BWOPO-vågen undersöktes även genom pulskomprimering. I dettaexperiment så överfördes 220 GHz bandbredd från 800 nm till en 150 ps lång puls vid 1.4 μm,vilken kunde komprimeras till 1.3 ps i en enkel-gitterkompressor med μJ energi.

Place, publisher, year, edition, pages
KTH Royal Institute of Technology, 2019. p. 106
Series
TRITA-SCI-FOU ; 2019:15
Keywords
Nonlinear optics; Ferroelectrics
National Category
Atom and Molecular Physics and Optics
Research subject
Physics
Identifiers
urn:nbn:se:kth:diva-251410 (URN)978-91-7873-183-1 (ISBN)
Public defence
2019-06-14, FA31, Albanova University Center, 10:00 (English)
Opponent
Supervisors
Note

QC20190514

Available from: 2019-05-14 Created: 2019-05-14 Last updated: 2019-05-14Bibliographically approved

Open Access in DiVA

No full text in DiVA

Other links

Publisher's full textPubMed

Authority records BETA

Zukauskas, AndriusViotti, Anne-LiseLiljestrand, CharlottePasiskevicius, ValdasCanalias, Carlota

Search in DiVA

By author/editor
Zukauskas, AndriusViotti, Anne-LiseLiljestrand, CharlottePasiskevicius, ValdasCanalias, Carlota
By organisation
Laser PhysicsPhysics
In the same journal
Scientific Reports
Atom and Molecular Physics and Optics

Search outside of DiVA

GoogleGoogle Scholar

doi
pubmed
urn-nbn

Altmetric score

doi
pubmed
urn-nbn
Total: 862 hits
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf