Change search
CiteExportLink to record
Permanent link

Direct link
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Coherent phase transfer and pulse compression at 1.4 µm in a backward-wave OPO
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0002-4452-0759
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0001-7688-1367
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0002-8091-195x
KTH, School of Engineering Sciences (SCI), Applied Physics, Laser Physics.ORCID iD: 0000-0003-2070-9167
Show others and affiliations
(English)Manuscript (preprint) (Other academic)
National Category
Atom and Molecular Physics and Optics
URN: urn:nbn:se:kth:diva-251009OAI:, id: diva2:1314125

QC 20190516

Available from: 2019-05-07 Created: 2019-05-07 Last updated: 2019-05-16Bibliographically approved
In thesis
1. Nonlinear optics in KTiOPO4 for spectral management of ultra-short pulses in the near- and mid-IR
Open this publication in new window or tab >>Nonlinear optics in KTiOPO4 for spectral management of ultra-short pulses in the near- and mid-IR
2019 (English)Doctoral thesis, comprehensive summary (Other academic)
Abstract [en]

This thesis explores the possibilities of controlling nonlinear optical interactions in ferroelectric materials for bandwidth tailoring of ultrashort pulses in the pico- and femto-second range. The control is achieved through quasi-phase matching, which is based on alternating the material’s spontaneous polarization into different domains. In the presented work, KTiOPO4 (KTP) is the material of choice as it provides high optical nonlinearity, a wide transparency window in the near- and mid-infrared (IR), as well as a high damage threshold. Furthermore, KTP also enables fabrication of uniform high aspect ratio and fine-pitch domain structures of high quality. These qualities make KTP highly attractive for a vast range of applications and enabled much of the work presented in this thesis.The propagation of ultrashort pulses in domain-structured ferroelectrics was studied numerically with a model based on a single nonlinear envelope equation. This model accounts for the absorption and the dispersion of the material, as well as the second- and the third-order nonlinearities. Supercontinuum generation in the near- and mid-IR was studied in periodically structured KTP for femtosecond pulses at 1.5 μm. The numerical results showed the potential for pulse self-compression with octave-spanning spectral broadening. This process is enabled by cascaded second-order nonlinearities and can be tailored by the phase-matching parameters, which are set by the structure’s periodicity. The proposed design presented in this work resulted in a negative effective Kerr nonlinear coefficient with a magnitude of 1.65x10-14 cm2/W in the positive dispersion regime, which is one order of magnitude higher than the natural Kerr coefficient in KTP. Experimental characterization of single pass propagation of 128 fs-long pulses at 1.52 μm through a periodically structured KTP sample, with a periodicity of 36 μm based on the proposed design, are also presented. The results show a spectral broadening from 1.1 μm to 2.7 μm and a simultaneous compression down to 18.6 fs, thus confirming the numerical findings. Bandwidth tailoring of ultrashort IR pulses in the picosecond range was also studied through devices known as backward-wave optical parametric oscillators (BWOPOs). These devices rely on sub-micrometer domain periods to generate counter-propagating signal and idler waves. In a BWOPO, the forward-generated wave inherits the phase modulation of the pump wave, while the backward-generated wave is inherently narrowband and basically insensitive to pump wavelength tuning. In this work, BWOPOs operated in a cascaded manner, with the forward-generated wave being employed as a pump in a single pass configuration, were studied. The tunability issue of the narrowband backward wave was solved by employing a broadband optical parametric amplifier seeded by the BWOPO forward wave. A tunability of 2.7 THz for a wave at 1.87 μm with a bandwidth of 28 GHz was demonstrated. The coherent phase transfer from the pump to the BWOPO forward wave was investigated in the context of pulse compression. In this experiment, a 220 GHz bandwidth was transferred from 800 nm to 150 ps-long pulses at 1.4 μm, which could be compressed down to 1.3 ps with μJ energy, in a single-grating compressor.

Abstract [sv]

I den här avhandlingen undersöks möjligheterna att kontrollera ickelinjära optiska processer iferroelektriska material. Detta för att kunna anpassa bandbredden hos ultrakorta pulser i piko- ochfemtosekundsområdena. Processerna kontrolleras genom kvasifasmatchning, vilket innebär attmaterialets spontana polarisation alterneras på ett sätt som ger upphov till olika domäner. Arbetetsom presenteras här avser främst användandet av kristallen KTiOPO4 (KTP), då den har en högoptisk ickelinjäritet, en bred transmission i de nära- och mellan-infraröda områdena samt en högskadetröskel. Dessutom möjliggör KTP tillverkning av uniforma samt finstrukturerade domänermed hög kontrast och kvalitet. Dessa egenskaper gör KTP till ett attraktivt material för en stormängd tillämpningar och har möjliggjort mycket av arbetet i denna avhandling.Utbredning av ultrakorta pulser i domänstrukturerade ferroelektriska material studeradesnumeriskt med en modell som baserades på en ickelinjär amplitudekvation. Modellen tar hänsyntill materialets absorption och dispersion så väl som andra- och tredje ordningens ickelinjäriteter.Superkontinuumgenerering i det nära- och mellan-infraröda området undersöktes för periodisktstrukturerat KTP i fallet med femtosekundspulser vid 1.5 μm. Beräkningarna visade att pulsernakan genomgå självkomprimering i samband med en oktavsträckande spektral breddning. Dessaprocesser möjligörs av kaskaderade andra ordningens ickelinjäriteter och kan anpassas medkvasifasmatchningsparametrarna, vilka bestäms av strukturens periodicitet. Designen sompresenteras i detta arbete gav upphov till en negativ effektiv ickelinjär Kerr-koefficient med enstorlek på 1.651014 cm2/W i det positiva dispersionsområdet, vilket är en storleksordning högreän den naturliga Kerr-koefficienten i KTP. Karaktäriseringen av ett enkelpasseringsexperimentmed en 128 fs-puls vid 1.52 μm propagerandes genom en periodiskt strukturerad KTP-kristall,med en periodicitet på 36 μm, presenteras också. Resultaten visar på en spektral breddning från1.1 μm till 2.7 μm samt en komprimering ner till 18.6 fs, vilket således verifierar de numeriskaresultaten.Möjligheten att anpassa bandbredden för ultrakorta infraröda pulser studerades även ipikosekundsområdet med s.k. baklängesvågs-optiska parametriska oscillatorer (BWOPO). Denhär sortens system bygger på domänstrukturer med sub-mikrometerperioder för att genereramotpropagerande signal- och komplementärsignalvågor. I dessa system får den framåtgenereradevågen samma fasmodulation som pumpvågen, medan den bakåtgenererade vågen är intrinsisktsmalbanding och i stort sett okänslig för ändringar i pumpvåglängden. I detta arbete studeraskaskaderade BWOPO-system, där den framåtgenererade vågen används som pump i enenkelpasseringskonfiguration. Problemet med att ändra våglängden på den smalbandigabakåtpropagerande signalen löstes genom att passera den genom en bredbanding optiskparametrisk förstärkare, vilket möjliggjorde ett frekvensskift på 2.7 THz för en våglängd kring1.87 μm med en bandbredd på 28 GHz. Den koherenta fasöverföringen från pumpen till denframåtpropagerande BWOPO-vågen undersöktes även genom pulskomprimering. I dettaexperiment så överfördes 220 GHz bandbredd från 800 nm till en 150 ps lång puls vid 1.4 μm,vilken kunde komprimeras till 1.3 ps i en enkel-gitterkompressor med μJ energi.

Place, publisher, year, edition, pages
KTH Royal Institute of Technology, 2019. p. 106
TRITA-SCI-FOU ; 2019:15
Nonlinear optics; Ferroelectrics
National Category
Atom and Molecular Physics and Optics
Research subject
urn:nbn:se:kth:diva-251410 (URN)978-91-7873-183-1 (ISBN)
Public defence
2019-06-14, FA31, Albanova University Center, 10:00 (English)


Available from: 2019-05-14 Created: 2019-05-14 Last updated: 2019-05-14Bibliographically approved

Open Access in DiVA

No full text in DiVA

Authority records BETA

Viotti, Anne-LiseLaurell, FredrikZukauskas, AndriusCanalias, CarlotaPasiskevicius, Valdas

Search in DiVA

By author/editor
Viotti, Anne-LiseLaurell, FredrikZukauskas, AndriusCanalias, CarlotaPasiskevicius, Valdas
By organisation
Laser Physics
Atom and Molecular Physics and Optics

Search outside of DiVA

GoogleGoogle Scholar


Altmetric score

Total: 11 hits
CiteExportLink to record
Permanent link

Direct link
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf