Ändra sökning
Avgränsa sökresultatet
45678910 301 - 350 av 512
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf
Träffar per sida
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
  • Standard (Relevans)
  • Författare A-Ö
  • Författare Ö-A
  • Titel A-Ö
  • Titel Ö-A
  • Publikationstyp A-Ö
  • Publikationstyp Ö-A
  • Äldst först
  • Nyast först
  • Skapad (Äldst först)
  • Skapad (Nyast först)
  • Senast uppdaterad (Äldst först)
  • Senast uppdaterad (Nyast först)
  • Disputationsdatum (tidigaste först)
  • Disputationsdatum (senaste först)
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 301.
    Martin-Serrano Ortiz, Angela
    et al.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Stenström, Patrik
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Antunez, Pablo Mesa
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Torres, Maria J.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Montanez, Maria I.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Design of multivalent fluorescent dendritic probes for site-specific labeling of biomolecules2018Ingår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 56, nr 15, s. 1609-1616Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Herein, the synthesis and characterization of orthogonal dendrons decorated with multiple units of fluorescent and a chemoselective group at a focal point, followed by specific antibody labeling, is presented. Fluorescence results confirm the applicability of the fluorescent probes for biomolecule labeling and fluorescent signal amplification.

  • 302.
    Martín-Yerga, Daniel
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Kemiteknik, Tillämpad elektrokemi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Cornell, Ann M.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Kemiteknik, Tillämpad elektrokemi.
    Effects of Incorporated Iron or Cobalt on the Ethanol Oxidation Activity of Nickel (Oxy)Hydroxides in Alkaline Media2019Ingår i: Electrocatalysis, ISSN 1868-2529, E-ISSN 1868-5994Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Nickel (oxy)hydroxides (NiOxHy) are promising cost-effective materials that exhibit a fair catalytic activity for the ethanol oxidation reaction (EOR) and could be used for sustainable energy conversion. Doping the NiOxHy structure with other metals could lead to enhanced catalytic properties but more research needs to be done to understand the role of the doping metal on the EOR. We prepared NiOxHy films doped with Fe or Co with different metallic ratios by electrodeposition and evaluated the EOR. We found a positive and negative effect on the catalytic activity after the incorporation of Co and Fe, respectively. Our results suggest that Ni atoms are the active sites for the EOR since Tafel slopes were similar on the binary and pristine nickel (oxy)hydroxides and that the formal potential of the Ni(II)/Ni(III) redox couple is a good descriptor for the EOR activity. This work also highlights the importance of controlled metal doping on catalysts and may help in the design and development of improved materials for the EOR.

  • 303.
    McGivney, Eric
    et al.
    Stockholm Univ, Analyt Chem & Environm Sci, Stockholm, Sweden..
    Cederholm, Linnea
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Ogonowski, Martin
    Stockholm Univ, Analyt Chem & Environm Sci, Stockholm, Sweden..
    Barth, Andreas
    Stockholm Univ, Biochem & Biophys, Stockholm, Sweden..
    Hakkarainen, Minna
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Hamacher-Barth, Evelyne
    Stockholm Univ, Biochem & Biophys, Stockholm, Sweden..
    Motiei, Asa
    Stockholm Univ, Analyt Chem & Environm Sci, Stockholm, Sweden..
    Gorokhova, Elena
    Stockholm Univ, Analyt Chem & Environm Sci, Stockholm, Sweden..
    What happens to microplastics when they enter the sea: A two week characterization study2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 304.
    Medina, Lilian
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer.
    High Clay Content Cellulose Nanocomposites for Mechanical Performance and Fire Retardancy2019Doktorsavhandling, sammanläggning (Övrigt vetenskapligt)
    Abstract [sv]

    Material baserade på trä kan erbjuda hållbara alternativ till fossilbaserade plaster och kompositer, men deras brandegenskaper är inte särskilt goda. I denna avhandling undersöks miljövänliga, brandskyddade nanokompositer från cellulosa/nanolera. Arbetet fokuserar särskilt på struktur-egenskapsrelationer och fysikaliska egenskaper hos dessa material. Avhandlingen är uppbyggd i två delar. Den första delen handlar om pappersliknande material, betecknade som "filmer". Den andra delen diskuterar material med hög porositet, så kallade "skum".

    I den första delen framställs filmer av lera (montmorillonit) och nanofibriller från cellulosa genom filtrering från vattensuspension. Kompositionen varieras systematiskt (från 0 till 100% lera) och effekter på nanostrukturen undersöks med hjälp av synkrotronröntgen, heliumpyknometri och mikroskopi. Mekaniska egenskaper hos filmerna mäts genom dragprovning, och optisk transmittans / haze där det visar sig att nanostrukturen är betydelsefull. En film med 50 viktprocent lera används som en brandskyddande ytskikt på trä, med konkalorimetri-experiment för att mäta brandegenskaper. Dessa filmer impregneras med epoxi och härdas, och bildar ternära kompositer av nanocellulosa, lera och epoxi. Dessa ternära nanokompositer visar goda mekaniska och gasbarriär-egenskaper i fuktig miljö.

    I den andra delen framställs skum med hög porositet genom frystorkning av en suspension baserad på polyvinylalkohol, cellulosa nanofibriller och lera. Cellstrukturen analyseras med elektronmikroskopi, och effekter från sammansättning och tvärbindning analyseras. Skummens tryckegenskaper mäts och relateras till struktur. Polyvinylalkohol påverkar termisk nedbrytning hos nanocellulosa i närvaro av katalyserande lera så att brandhämmande egenskaper försämras.

    Publikationen är tillgänglig i fulltext från 2020-04-22 20:25
  • 305.
    Medina, Lilian
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Ansari, Farhan
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Carosio, Federico
    Salajkova, Michaela
    Berglund, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Nanocomposites from Clay, Cellulose Nanofibrils, and Epoxy with Improved Moisture Stability for Coatings and Semi-Structural Applications2019Ingår i: ACS Applied Nano Materials, E-ISSN 2574-0970Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    A new type of high reinforcement content clay-cellulose-thermoset nanocomposite was proposed, where epoxy precursors diffused into a wet porous clay-nanocellulose mat, followed by curing. The processing concept was scaled to > 200 µm thickness composites, the mechanical properties were high for nanocomposites and the materials showed better tensile properties at 90% RH compared with typical nanocellulose materials. The nanostructure and phase distributions were studied using transmission electron microscopy; Young’s modulus, yield strength, ultimate strength and ductility were determined as well as moisture sorption, fire retardancy and oxygen barrier properties. Clay and cellulose contents were varied, as well as the epoxy content. Epoxy had favorable effects on moisture stability, and also improved reinforcement effects at low reinforcement content. More homogeneous nano- and mesoscale epoxy distribution is still required for further property improvements. The materials constitute a new type of three-phase nanocomposites, of interest as coatings, films and as laminated composites for semi-structural applications.

  • 306.
    Medina, Lilian
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Berglund, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Brick-and-mortar biocomposites from cellulose nanofibrils and clay nanoplatelets2018Ingår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Artikel i tidskrift (Övrigt vetenskapligt)
  • 307.
    Medina, Lilian
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer.
    Carosio, Federico
    Politecnico di Torino.
    Berglund, Lars
    KTH, Skolan för teknikvetenskap (SCI), Farkost och flyg. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Recyclable Nanocomposite Foams of Poly(vinyl alcohol), Clay and Cellulose Nanofibrils - Mechanical Properties and Flame RetardancyManuskript (preprint) (Övrigt vetenskapligt)
  • 308.
    Medina, Lilian
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Nishiyama, Yoshiharu
    Univ. Grenoble Alpes, CNRS,CERMAV, 38000 Grenoble, France.
    Daicho, Kazuho
    University of Tokyo, Japan.
    Saito, Tsuguyuki
    University of Tokyo, Japan.
    Yan, Min
    KTH, Skolan för teknikvetenskap (SCI).
    Berglund, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Nanostructure and Properties of Nacre-Inspired Clay/Cellulose Nanocomposites—Synchrotron X-ray Scattering Analysis2019Ingår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 52, nr 8, s. 3131-3140Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Nacre-inspired clay nanocomposites have excellent mechanical properties, combined with optical transmittance, gas barrier properties, and fire retardancy, but the mechanical properties are still below predictions from composite micromechanics. The properties of montmorillonite clay/nanocellulose nanocomposite hybrids are investigated as a function of clay content and show a maximum Young’s modulus as high as 28 GPa. Ultimate strength, however, decreases from 280 to 125 MPa between 0 and 80 wt % clay. Small-angle and wide-angle X-ray scattering data from synchrotron radiation are analyzed to suggest nanostructural and phase interaction factors responsible for these observations. Parameters discussed include effective platelet modulus, platelet out-of-plane orientation distribution, nanoporosity, and platelet agglomeration state.

  • 309.
    Meister, Sebastian
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Proteinvetenskap, Proteinteknologi.
    Hendrikse, Natalie
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Löfblom, John
    KTH, Skolan för teknikvetenskap (SCI).
    Directed evolution of the 3C protease from coxsackievirus using a novel fluorescence-assisted intracellular method2019Ingår i: Biological chemistry (Print), ISSN 1431-6730, E-ISSN 1437-4315, Vol. 400, nr 3, s. 405-415Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Proteases are crucial for regulating biological processes in organisms through hydrolysis of peptide bonds. Recombinant proteases have moreover become important tools in biotechnological, and biomedical research and as therapeutics. We have developed a label-free high-throughput method for quantitative assessment of proteolytic activity in Escherichia coli. The screening method is based on co-expression of a protease of interest and a reporter complex. This reporter consists of an aggregation-prone peptide fused to a fluorescent protein via a linker that contains the corresponding substrate sequence. Cleavage of the substrate rescues the fluorescent protein from aggregation, resulting in increased fluorescence that correlates to proteolytic activity, which can be monitored using flow cytometry. In one round of flow-cytometric cell sorting, we isolated an efficiently cleaved tobacco etch virus (TEV) substrate from a 1:100 000 background of non-cleavable sequences, with around 6000-fold enrichment. We then engineered the 3C protease from coxsackievirus B3 (CVB3 3C(pro)) towards improved proteolytic activity on the substrate LEVLFQ down arrow GP. We isolated highly proteolytic active variants from a randomly mutated CVB3 3C(pro) library with up to 4-fold increase in activity. The method enables simultaneous measurement of proteolytic activity and protease expression levels and can therefore be applied for protease substrate profiling, as well as directed evolution of proteases.

  • 310.
    Mendoza Alvarez, Ana Isabel
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Moriana Torro, Rosana
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymera material. HIS Hogskolan I Skovde, Engn Sci, Hogskolevagen 1, SE-54128 Skovde, Sweden ; SLU Swedish Univ Agr Sci, Almas Alle 5, SE-75007 Uppsala, Sweden.
    Hillborg, Henrik
    ABB Corp Res, Power Technol, SE-72226 Vasteras, Sweden..
    Strömberg, Emma
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Super-hydrophobic zinc oxide/silicone rubber nanocomposite surfaces2019Ingår i: SURFACES AND INTERFACES, ISSN 2468-0230, Vol. 14, s. 146-157Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    This study presents comparative assessments on hydrophilic and hydrophobic ZnO nanoparticles and their deposition methods on the surface hydrophobicity of silicone rubber (PDMS) and glass substrates. The influence on the surface hydrophobicity and wettability of all the variables regarding the deposition methodologies and the interaction of the nanoparticles with the substrates were within the scope of this study. The different surfaces created by spraying, dipping and drop-pipetting deposition methods were assessed by static contact angle measurements and contact angle hysteresis from advancing and receding angles, as well as by the calculation of the sliding angle and the surface energy parameters. An accurate methodology to determine the contact angle hysteresis was proposed to obtain repetitive and comparative results on all surfaces. All the measurements have been correlated with the morphology and topography of the different surfaces analysed by FE-SE microscopy. The spray-deposition of hydrophobic ZnO nanoparticles on PDMS resulted in super-hydrophobic surfaces, exhibiting hierarchical structures with micro-and nanometer features which, together with the low surface energy, promotes the Cassie-Baxter wetting behavior. This study provides the fundamental approach to select critically the most promising combination in terms of materials and deposition techniques to create silicone-based super-hydrophobic surfaces with potential to be applied in high voltage outdoor insulation applications.

  • 311.
    Mendoza, Ana
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Fiberteknologi.
    Hillborg, H.
    Strömberg, Emma
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Superhydrophobic self-regenerative silicone rubber nanocomposites for electrical outdoor insulation2015Ingår i: ICCM International Conferences on Composite Materials, International Committee on Composite Materials , 2015Konferensbidrag (Refereegranskat)
    Abstract [en]

    The overall objective of this project is to develop new structural composite materials for high voltage outdoor insulation applications using silicone rubber (PDMS) coated with micro- and nanoparticles. The goal is to obtain hierarchical superhydrophobic surfaces, with antifogging, antifouling and self-cleaning ability. This will minimize surface leakage currents and subsequent surface flash over of the insulator. In order to achieve both the superhydrophobic and self-cleaning ability, a combination of different surface chemistry of the particles has been investigated. Three different deposition techniques, including spraying of ROD ultrasonicated ZnO suspensions were investigated. Pure silicone rubber (SYLGARD® 184) was coated with hydrophobic and hydrophilic inorganic micro- and nanoparticles (ZnO). The effect of the different factors, such as particle surface chemistry and the deposition method, on the hydrophobicity of the surface has been investigated using static and dynamic contact angle measurements. The objective has been to achieve the highest static contact angle combined with the lowest possible hysteresis. The results showed that the spraying method was more suitable when using PDMS as matrix. The link between superhydrophobicity and the surface structure has been assessed by Scanning Electron Microscopy. The next step towards a self-regenerative composite material is approached by the incorporation of the optimal functionalised nanoparticles into the bulk material. The dynamic behaviour of silicone rubber presents a challenge for the stability of micro- and nanocomposites. Different mechanical techniques and methods of integration are being investigated for improvement of the homogeneity of the composites. Preliminary studies have been performed evaluating the effect of the curing time of the PDMS on the degree of incorporation of the nanoparticles in the surface and uniformity within the bulk. The behaviour of the nanocomposite and the evolution of the different properties with time and environmental conditions will be studied in the next phase of the project. 

  • 312. Michalak, M.
    et al.
    Jurczyk, S.
    Jelonek, K.
    Hakkarainen, Minna
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Kurcok, P.
    Polyhydroxyalkanoates as promising materials in biomedical systems2017Ingår i: Frontiers in Drug Design and Discovery, nr 1, s. 242-288Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Polyhydroxyalkanoates (PHAs) are the natural polymers that have been a subject of a significant research interest in the past few decades. The PHAs (natural as well as their synthetic analogs) as biodegradable and biocompatible polymers were studied intensively for biomedical applications, that is, scaffolds for tissue engineering. Drug-loaded implants or scaffolds based on these polyesters were also used in the drug release systems. Drug delivery systems should provide an optimal release profile of an active compound that allows to increase therapeutic effect, decrease side effects, and improve patient convenience and compliance. Therefore, recently, the increasing interest is focused on the use of PHA as drug carriers because of significant improvement in the bioavailability of bioactive substances. Recent developments introduced such strategies as conjugation of the drug with low-molecular-weight poly(3-hydroxybutyrate) or preparation of PHA particles loaded with the drug. On the contrary, there is a growing interest in functionalized PHA technology. The advancement of these strategies allows to obtain the targeting systems based on the chemical modification, for example, by folic acid attachment or biosynthesis of targeting proteins on the PHA particle surface. In addition, the PHAs were presented as materials that could be used in transdermal administration of bioactive substances for medical or cosmetic purposes. The development of novel functionalized PHAs has opened new possibilities to combine good biocompatibility of PHA-based drug delivery systems with improved drug loading and release properties, targeting, or imaging possibilities. Further progress in PHA-based drug delivery systems is expected because of the combination of excellent biocompatibility of these biopolymers and strong beneficial effect on drug administration. 

  • 313.
    Mittal, Nitesh
    et al.
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Ansari, Farhan
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. Department of Materials Science and Engineering, Stanford University, Stanford, CA, United States.
    Gowda, Krishne, V
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW.
    Brouzet, Christophe
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW.
    Chen, Pan
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Larsson, Per Tomas
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. RISE Bioeconomy, P.O. Box 5604, Stockholm, SwedenRISE Bioeconomy, P.O. Box 5604, Stockholm, Sweden.
    Roth, Stephan Volkher
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Lundell, Fredrik
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Wågberg, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Kotov, Nicholas Alexander
    Söderberg, Daniel
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Multiscale Control of Nanocellulose Assembly: Transferring Remarkable Nanoscale Fibril Mechanics to Macroscale Fibers2018Ingår i: ACS Nano, ISSN 1936-0851, E-ISSN 1936-086X, Vol. 12, nr 7, s. 6378-6388Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Nanoscale building blocks of many materials exhibit extraordinary mechanical properties due to their defect-free molecular structure. Translation of these high mechanical properties to macroscopic materials represents a difficult materials engineering challenge due to the necessity to organize these building blocks into multiscale patterns and mitigate defects emerging at larger scales. Cellulose nanofibrils (CNFs), the most abundant structural element in living systems, has impressively high strength and stiffness, but natural or artificial cellulose composites are 3-15 times weaker than the CNFs. Here, we report the flow-assisted organization of CNFs into macroscale fibers with nearly perfect unidirectional alignment. Efficient stress transfer from macroscale to individual CNF due to cross-linking and high degree of order enables their Young's modulus to reach up to 86 GPa and a tensile strength of 1.57 GPa, exceeding the mechanical properties of known natural or synthetic biopolymeric materials. The specific strength of our CNF fibers engineered at multiscale also exceeds that of metals, alloys, and glass fibers, enhancing the potential of sustainable lightweight high-performance materials with multiscale self-organization.

  • 314.
    Mittal, Nitesh
    et al.
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Lundell, Fredrik
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Wågberg, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Hedhammar, My
    Söderberg, Daniel
    KTH, Skolan för teknikvetenskap (SCI), Mekanik. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Flow-assisted organization of nanostructured bio-based materials2018Ingår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Artikel i tidskrift (Övrigt vetenskapligt)
  • 315.
    Moliner, C.
    et al.
    Univ Genoa, DICCA, Via Opera Pia 15, I-16145 Genoa, Italy.;Univ Politecn Valencia, ITM, Camino Vera S-N, E-46022 Valencia, Spain..
    Badia, J. D.
    Univ Politecn Valencia, ITM, Camino Vera S-N, E-46022 Valencia, Spain.;Univ Valencia, Escola Tecn Super Engn, Dept Engn Quim, Av Univ S-N, E-46100 Burjassot, Spain..
    Bosio, B.
    Univ Genoa, DICCA, Via Opera Pia 15, I-16145 Genoa, Italy..
    Arato, E.
    Univ Genoa, DICCA, Via Opera Pia 15, I-16145 Genoa, Italy..
    Teruel-Juanes, R.
    Univ Politecn Valencia, ITM, Camino Vera S-N, E-46022 Valencia, Spain..
    Kittikorn, Thorsak
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. Prince Songkla Univ, Fac Sci, Dept Mat Sci & Technol, Hat Yai 90112, Thailand..
    Strömberg, Emma
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Ek, Monica
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Karlsson, Sigbritt
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Ribes-Greus, A.
    Univ Politecn Valencia, ITM, Camino Vera S-N, E-46022 Valencia, Spain..
    Thermal kinetics for the energy valorisation of polylactide/sisal biocomposites2018Ingår i: Thermochimica Acta, ISSN 0040-6031, E-ISSN 1872-762X, Vol. 670, s. 169-177Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    The thermal stability and decomposition kinetics of PLA/sisal biocomposites was discussed to evaluate the suitability of their use in energy recovery processes such as pyrolysis and combustion. The influence of the addition of sisal up to 30%wt, the presence of coupling agent, and the atmosphere of operation, i.e. inert or oxidative was discussed by means of multi-rate linear non-isothermal thermogravimetric experiments. All biocomposites showed a mean high heating value of 15 MJ/kg indicating their suitability for energy recovery processes. The thermal requirements of PLA/sisal decomposition were assessed in terms of onset decomposition temperature and apparent activation energy. A minimum of 240 degrees C and 174 kJ mol(-1) in inert environment and 225 degrees C and 190 kJ mol(-1) in oxidative environment ensured the feasibility of the reactions regardless the composition of the PLA/sisal biocomposites. The atmosphere of work lead to a greater amount of residue in case of pyrolysis reactions that would need further treatment whereas an oxidative atmosphere resulted in nearly zero final waste stream. The similar kinetics obtained for all samples regardless the amount of sisal or use of coupling agent eases the operability of energy facilities aimed of turning these biowastes into new fuels.

  • 316.
    Montanari, Celine
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH Royal Inst Technol, Fibre & Polymer Technol, Stockholm, Sweden..
    Li, Yuanyuan
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH Royal Inst Technol, Fibre & Polymer Technol, Stockholm, Sweden..
    Berglund, Lars
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH Royal Inst Technol, Fibre & Polymer Technol, Stockholm, Sweden..
    Multifunctional transparent wood for thermal energy storage applications2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 317.
    Montanari, Celine
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Li, Yuanyuan
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Chen, Hui
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Yan, Max
    KTH, Skolan för teknikvetenskap (SCI), Tillämpad fysik.
    Berglund, Lars A.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Transparent Wood for Thermal Energy Storage and Reversible Optical Transmittance2019Ingår i: ACS Applied Materials and Interfaces, ISSN 1944-8244, E-ISSN 1944-8252, Vol. 11, nr 22, s. 20465-20472Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Functional load-bearing materials based on phase-change materials (PCMs) are under rapid development for thermal energy storage (TES) applications. Mesoporous structures are ideal carriers for PCMs and guarantee shape stability during the thermal cycle. In this study, we introduce transparent wood (TW) as a TES system. A shape-stabilized PCM based on polyethylene glycol is encapsulated into a delignified wood substrate, and the TW obtained is fully characterized; also in terms of nano- and mesoscale structures. Transparent wood for thermal energy storage (TW-TES) combines large latent heat (similar to 76 J g(-1)) with switchable optical transparency. During the heating process, optical transmittance increases by 6% and reaches 68% for 1.5 mm thick TW-TES. Characterization of the thermal energy regulation performance shows that the prepared TW-TES composite is superior to normal glass because of the combination of good heat-storage and thermal insulation properties. This makes TW-TES composites interesting candidates for applications in energy-saving buildings.

  • 318.
    Moon, Hyunwoo
    et al.
    Pohang Univ Sci & Technol POSTECH, Div Environm Sci & Engn, 77 Chengam Ro, Pohang 37673, South Korea..
    Choy, Seunghwan
    Pohang Univ Sci & Technol POSTECH, Div Integrat Biosci & Biotechnol, 77 Chengam Ro, Pohang 37673, South Korea..
    Park, Yeonju
    Kangwon Natl Univ, Inst Mol Sci & Fus Technol, Dept Chem, Chunchon 24341, South Korea..
    Jung, Young Mee
    Kangwon Natl Univ, Inst Mol Sci & Fus Technol, Dept Chem, Chunchon 24341, South Korea..
    Koo, Jun Mo
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Hwang, Dong Soo
    Pohang Univ Sci & Technol POSTECH, Div Environm Sci & Engn, 77 Chengam Ro, Pohang 37673, South Korea.;Pohang Univ Sci & Technol POSTECH, Div Integrat Biosci & Biotechnol, 77 Chengam Ro, Pohang 37673, South Korea..
    Different Molecular Interaction between Collagen and alpha- or beta-Chitin in Mechanically Improved Electrospun Composite2019Ingår i: Marine Drugs, ISSN 1660-3397, E-ISSN 1660-3397, Vol. 17, nr 6, artikel-id 318Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Although collagens from vertebrates are mainly used in regenerative medicine, the most elusive issue in the collagen-based biomedical scaffolds is its insufficient mechanical strength. To solve this problem, electrospun collagen composites with chitins were prepared and molecular interactions which are the cause of the mechanical improvement in the composites were investigated by two-dimensional correlation spectroscopy (2DCOS). The electrospun collagen is composed of two kinds of polymorphs, alpha- and beta-chitin, showing different mechanical enhancement and molecular interactions due to different inherent configurations in the crystal structure, resulting in solvent and polymer susceptibility. The collagen/alpha-chitin has two distinctive phases in the composite, but beta-chitin composite has a relatively homogeneous phase. The beta-chitin composite showed better tensile strength with similar to 41% and similar to 14% higher strength compared to collagen and alpha-chitin composites, respectively, due to a favorable secondary interaction, i.e., inter- rather than intra-molecular hydrogen bonds. The revealed molecular interaction indicates that beta-chitin prefers to form inter-molecular hydrogen bonds with collagen by rearranging their uncrumpled crystalline regions, unlike alpha-chitin.

  • 319.
    Moriana, Rosana
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Strömberg, Emma
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Ribes, Amparo
    Univ Politecn Valencia, Sch Design Engn ETSID, ITM, E-46022 Valencia, Spain..
    Karlsson, Sigbritt
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Degradation Behaviour of Natural Fibre Reinforced Starch-Based Composites under Different Environmental Conditions2014Ingår i: Journal of Renewable Materials, ISSN 2164-6325, E-ISSN 2164-6341, Vol. 2, nr 2, s. 145-156Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    The purpose of this work was to study the effect of hydrothermal, biological and photo degradation on natural fibres reinforced biodegradable starch-based (Mater-BiKE) composites to characterize the structural changes occurring under exposure to different environments. The composites water-uptake rate was hindered by the interfacial interactions between matrix and fibres. Thermal, structural and morphological analysis provided useful information about the irreversible changes in the properties of the composites caused by degradation in soil and photodegradation, and their synergetic effects. The effects due to the photo-oxidation and degradation in soil on the composites depended on the different chemical composition of each fibre. The composite with more hemicellulose and lignin in its formulation was more affected by both types of degradation, but still the end result properties were better than the ones shown for the degraded Mater-BiKE. The photo-oxidation of all the studied materials achieved enhanced degradation rate in soil. The Mater-BiKE/kenaf was shown to have the slowest water-uptake rate and better thermal properties once photo-oxidized, indicating better service life conditions. At the same time, the Mater-BiKE/kenaf was affected to a major extent by the synergetic effects of both photo-oxidation and soil burial test, showing a faster degradative rate and better disposal conditions.

  • 320.
    Moser, Carl
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Manufacturing and Characterization of Cellulose Nanofibers2018Doktorsavhandling, sammanläggning (Övrigt vetenskapligt)
    Abstract [sv]

    Användningen av träd har varit en viktig del under människans evolution. Dessa har tillåtit oss tillaga mat, tillverka verktyg, bygga hus och utforskavärlden. Fibrerna som ett träd är uppbyggt av har i form av papper varitdet viktigaste sättet att lagra och överföra kunnskap under århundranden. Detta fält betraktas ofta som ganska tråkigt och inte så hi-tech, vilket är långt ifrån sanningen. Ett av samhällets största problemen idag är hur manska leva på ett hållbart sätt, vilket är exakt vad vi kan lösa med hjälp avträd. Vi kan bygga höga byggnader av trä att bo i för att binda upp storamängder koldioxid. Vi kan ersätta många av de plaster vi idag användermed hållbara alternativ från de komponenter som utgör träd. Vi kan till och med göra kläder från våra träd för att sluta vara beroende av den ohållbara bomullsproduktionen - bara fantasin sätter gränser för vad som kan göras frånträd. Cellulosa är den huvudsakligen strukturella komponenten i trä, molekylen ordnar sig i en komplex hierarkisk struktur som bildar träcellerna eller fibrerna. Genom att bryta ner denna hierarkiska strukturen till dess minsta strukturella enhet, småfibrer, som bara är några mikrometer långa och meden bredd av ynka fyra nanometer. Dessa är cellulosa nanofibrer och syftetmed detta arbete har varit att förstå hur och vad som krävs för att frigöra dessa småfibrer från den större fiber som de utgör. Det finns principiellt två vägar att gå för att sönderdela en fiber till nanofibrer, antingen kemiskt genom introduktion av negativt laddade grupper på cellulosans yta, vilket gör att nanofibrerna stöter ifrån varandra, eller mekaniskt, genom intensivt mekanisk bearbetning av fibrerna. Dessa processer är emellertid förknippade med vissa brister i och med att (i) stor mängd energi krävs om inte fibrerna förbehandlas, (ii) delaminering utförs i instrument som inte skalar väl industriellt, (iii) delaminering utförs vid en låg koncentration av fibrer, typiskt under 5%. Dessutom är det svårt att karakterisera det som kommer ut med hänsyn till kvalité på grund av inhomogeniteten och den lilla storleken hos nanofibrerna. Dessa problem i kombination med en större förståelse av processerna är ämnet för denna avhandling. 

    Förmindskad energikonsumption och uppskalning undersöktes genom ett ångexplosionskonceptet, Nanopulping. För att undvika problemen associerade med den låga koncentrationen utvecklades en metod för att torka cellulosa nanofibrer till en pasta utan att orsaka hornifiering med hjälp av glycerol. En mängd cellulosa nanofibrer med olika utgångsmaterial framställdes och karaktäriseringstekniker jämfördes och utvecklades, denna utveckling innefattade bland annat en metod för att bättre beskriva ytan av cellulosa nanofibrer. Slutligen tillverkades en miljövänlig komposit från billiga och tillgängliga resurser i kombination med cellulosa nanofibrer.

  • 321.
    Moser, Carl
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Backlund, Hanéle
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Drenth, Louise
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Lindström, Mikael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Xyloglucan adsorption for measuring the specific surface area on various never-dried cellulose nanofibers2018Ingår i: Nordic Pulp & Paper Research Journal, ISSN 0283-2631, E-ISSN 2000-0669, Vol. 33, nr 2, s. 186-193Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    In this paper, we explore xyloglucan adsorption to cellulose nanofibers as a method for the evaluation of their quality (i. e., the degree of disintegration) and the accessible surface area in the wet state and at low ionic strength. This method was shown to be capable of estimating the surface areas of 14 different cellulose nanofiber qualities from both hardwood and softwood with different pretreatments, including enzymatic hydrolysis using a monocomponent endoglucanase, TEMPO-mediated oxidation, and carboxymethylation. The cellulose surface measured using this method showed a correlation with the degree of disintegration expressed as transmittance for different concentrations of xyloglucan.

  • 322.
    Moser, Carl
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Backlund, Hanéle
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Lindström, Mikael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Xyloglucan for estimating the surface area of cellulose fibers2018Ingår i: Nordic Pulp & Paper Research Journal, ISSN 0283-2631, E-ISSN 2000-0669, Vol. 33, nr 2, s. 194-199Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    The hemicellulose xyloglucan can be utilized to measure exposed cellulose surfaces for pulp fibers. This was shown by correlating a refining series with the adsorbed amount of xyloglucan, and by swelling cellulose fibers to various degrees by increasing the charge density. The method is specific to cellulose and could be used to quantify refining or to determine hornification.

  • 323.
    Moser, Carl
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Lindström, Mikael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Improved dispersibility of once-dried cellulose nanofibers in the presence of glycerol2018Ingår i: Nordic Pulp & Paper Research Journal, ISSN 0283-2631, E-ISSN 2000-0669Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    To investigate the dispersibility of dried cellulose nanofibers (CNFs), various additions (glycerol, octanol, glycol, and sodium perchlorate) were added to CNFs prior to drying. Glycerol was the only species to show any significant effect on re-dispersibility. The sedimentation was slower, and the transmittance of the solution was comparable to that of its undried counterpart. Increasing the amount of glycerol showed a clear trend with regard to dispersibility. The mechanical properties of films were maintained for samples that were dried and redispersed in the presence of glycerol.

  • 324.
    Moser, Carl
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Lindström, Mikael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Structural aspects on the manufacturing of cellulose nanofibers from wood pulp fibers2019Ingår i: BioResources, ISSN 1930-2126, E-ISSN 1930-2126, Vol. 14, nr 1, s. 2269-2276Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    The exact mechanism behind the disintegration of chemical pulp fiber into cellulose nanofibers is poorly understood. In this study, samples were subjected to various homogenization cycles, indicating that the mechanism is a stepwise process. In the earlier stages of the mechanical process, a large amount of macrofibrils were created as the larger structures disappeared. Upon mechanical treatment these macrofibrils disappeared despite the increasing yield of cellulose nanofibers. The proposed model expands the understanding of the disintegration pathway and may provide additional insight as to how wood cells are converted into microfibrils.

  • 325.
    Moser, Carl
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Lindström, Mikael E.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Henriksson, Gunnar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Träkemi och massateknologi.
    Structural aspects on the manufacturing of cellulose nanofibers from wood pulp fibersManuskript (preprint) (Övrigt vetenskapligt)
  • 326.
    Moyassari, Ali
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Gkourmpis, Thomas
    Borealis AB, Innovat & Technol, SE-44486 Stenungsund, Sweden..
    Hedenqvist, Mikael S.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymera material.
    Gedde, Ulf W
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Molecular dynamics simulation of linear polyethylene blends: Effect of molar mass bimodality on topological characteristics and mechanical behavior2019Ingår i: Polymer, ISSN 0032-3861, E-ISSN 1873-2291, Vol. 161, s. 139-150Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Blending different molar mass fractions of polyethylene (PE) in order to obtain materials with higher fracture toughness has previously proven beneficial. Our approach has been to use coarse-grained (CG) molecular dynamics (MD) simulations to obtain semicrystalline polyethylene systems on a nanoscale, and then draw them in order to mimic tensile testing. The CG potentials were derived, validated and utilized to simulate melt equilibration, cooling, crystallization and mechanical deformation. Crystallinity, tie chain and entanglement concentrations were continuously monitored. During crystallization, the low molar mass fraction disentangled to a greater degree and ended up with a lower entanglement density than the high molar mass fraction, although the tie chain concentration was higher for the low molar mass fraction. The deformation behavior of semicrystalline PE above its glass transition temperature was then assessed in a uniaxial tensile deformation simulation. The low-strain mechanical properties (i.e. elastic modulus, yield stress and strain) were in accordance with the literature. The high-strain mechanical features and toughness were improved in bimodal systems. The presence of a high molar mass fraction in bimodal systems was shown to affect the crystallinity and tie chain concentration during the strain hardening, leading to tougher model systems. Finally, the bimodal system with equal shares of the molar mass fractions showed the highest toughness and the best ultimate mechanical properties while having a concentration of tie chains and entanglements intermediate between the values for the other systems. This was a clear sign of the non-exclusive role of tie chains and entanglements in the mechanical behavior of bimodal PE and more generally of semicrystalline polymers at high strains.

  • 327.
    Moyassari, Ali
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Gkourmpis, Thomas
    Borealis AB, Innovat & Technol, SE-44486 Stenungsund, Sweden..
    Hedenqvist, Mikael S.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Gedde, Ulf W.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Molecular Dynamics Simulations of Short-Chain Branched Bimodal Polyethylene: Topological Characteristics and Mechanical Behavior2019Ingår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 52, nr 3, s. 807-818Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    It has previously been shown that polyethylene (PE) with a bimodal molar mass distribution has a high fracture toughness. Our approach has been to use coarse-grained (CG) molecular dynamics (MD) simulations to investigate the effects of including short-chain branches in the high molar mass fraction of bimodal PE on topological features and mechanical behavior of the material. The CG potentials were derived, validated, and utilized to simulate melt equilibration, cooling, crystallization, and mechanical deformation. Crystallinity, tie chain, and entanglement concentrations were continuously monitored. During crystallization, the branched bimodal systems disentangled to a lesser degree and ended up with a higher entanglement density than the linear bimodal systems simulated in our previous study. The increase in entanglement concentration was proportional to the content of the branched high molar mass fraction. A significantly higher tie chain concentration was obtained in the short-chain branched bimodal systems than in the linear systems. The increase in the number of ties was more pronounced than the increase in the number of entanglements. The tie chain concentration was not proportional to the content of the high molar mass fraction. Despite a lower crystal thickness and content, the elastic modulus and yield stress values were higher in the branched bimodal systems. A more pronounced strain hardening region was observed in the branched systems. It was suggested that the higher tie chain and entanglement concentration prior to the deformation, the more extensive disentanglement during the deformation, and the disappearance of formed voids prior to failure point were the reasons for the observed higher toughness of the short-chain branched bimodal PE compared with that of the linear bimodal systems. The toughest system, which contained respectively 25 and 75 wt % low molar mass and branched high molar mass fractions, had the highest tie chain concentration and the second highest entanglement concentration of the simulated systems.

  • 328.
    Moyassari Sardehaei, Ali
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Molecular Structure, Interfacial Chain Topology, Electronic Structure and Fracture Toughness of Polyethylene: A Multiscale Computational Study2018Doktorsavhandling, sammanläggning (Övrigt vetenskapligt)
    Abstract [sv]

    Strukturen hos delkristallin polyeten (PE) har stor inverkan på materialets egenskaper. Två viktiga strukturella parametrar, koncentrationerna av sammanbindningsmolekyler och låsta kedjeihoptrasslingar, kan inte direkt bestämmas med tillgängliga experimentella metoder. Dessa parametrar har stor inverkan på materialets mekaniska egenskaper, i synnerhet på dess brottseghet. Avhandlingen har därför haft ett fokus på att utveckla metoder baserade på datasimulering för att kunna bestämma koncentrationerna av sammanbindningsmolekyler och låsta kedjeihoptrasslingar som funktion av molekylär struktur i enmodala och bimodala PE system.

    En icke-gitterbaserad Monte Carlo (MC) metod utvecklades för att simulera strukturen hos delkristallin PE. Den numeriska koden utgick från inmatade parametervärden för fördelningar av molmassa och förgreningsgrad, samt kristallinitetsgrad för att modellera den kristallina-amorfa lamellstrukturen med ett fokus på att bestämma koncentrationerna av sammanbindningsmolekyler och låsta kedjeihoptrasslingar. Införandet av kortkedjeförgrenat material gav en signifikant ökning av koncentrationerna av sammanbindningsmolekyler och låsta kedjeihoptrasslingar. Metoden nyttjades också för att bygga delkristallina multilamellstrukturer, som innan ytterligare simulering genomfördas bringades i jämvikt med hjälp av en molekyldynamik-(MD)-metod. En linjär DFT - (density functional theory) - metod användas för att kartlägga materialets elektriska egenskaper. Bandgapen hos den delkristallina modellen befanns vara mindre än för rena kristallina och rena amorfa modellsystem. Denna observation indikerar att elektroner har en tendens att befinna sig i gränsskikten mellan amorf och kristallin fas. De låga erhållna aktiveringsenergierna för mobilitet hos hål, elektroner och andra laddningsbärare vid rumstemperatur var anmärkningsvärd.

    Coarse-grained (ungefär grovskaliga (CG)) potentialfunktioner togs fram med hjälp av en iterativ-Boltzmann-inversions-(IBI)-metod för att beskriva linjär och grenad PE. Metoden användas för CG-MD-simuleringar för att kristallisera blandningar av nämnda bimodala (lågmolekylär komponent samt högmolekylär komponent) polymersystem.  Studiens syfte var att bestämma koncentrationerna av sammanbindningsmolekyler och låsta kedjeihoptrasslingar samt deras effekt på krypkomplians (vid flytning) och brottseghet. Addition av en linjär högmolekylär komponent (även vid lägre andelar, mindre än 25 vikt%) ökade avsevärt koncentrationen av låsta kedjeihoptrasslingar och därmed materialets brottseghet. Introduktion av butylgrenat, högmolekylärt material hade en ännu starkare effekt på koncentrationen av låsta kedjeihoptrasslingar och i synnerhet på sammanbindningsmolekylkoncentrationen. Dessa senare system uppvisade de allra högsta brottseghetsvärdena av alla studerade system.

  • 329.
    Muneer, Faraz
    et al.
    Swedish Univ Agr Sci, Dept Plant Breeding, Box 101, SE-23053 Alnarp, Sweden..
    Johansson, Eva
    Swedish Univ Agr Sci, Dept Plant Breeding, Box 101, SE-23053 Alnarp, Sweden..
    Hedenqvist, Mikael S.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymera material.
    Plivelic, Tomas S.
    Lund Univ, MAX IV Lab, Box 118, SE-22100 Lund, Sweden..
    Kuktaite, Ramune
    Swedish Univ Agr Sci, Dept Plant Breeding, Box 101, SE-23053 Alnarp, Sweden..
    Impact of pH Modification on Protein Polymerization and Structure-Function Relationships in Potato Protein and Wheat Gluten Composites2019Ingår i: International Journal of Molecular Sciences, ISSN 1422-0067, E-ISSN 1422-0067, Vol. 20, nr 1, artikel-id 58Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Wheat gluten (WG) and potato protein (PP) were modified to a basic pH by NaOH to impact macromolecular and structural properties. Films were processed by compression molding (at 130 and 150 degrees C) of WG, PP, their chemically modified versions (MWG, MPP) and of their blends in different ratios to study the impact of chemical modification on structure, processing and tensile properties. The modification changed the molecular and secondary structure of both protein powders, through unfolding and re-polymerization, resulting in less cross-linked proteins. The beta-sheet formation due to NaOH modification increased for WG and decreased for PP. Processing resulted in cross-linking of the proteins, shown by a decrease in extractability; to a higher degree for WG than for PP, despite higher beta-sheet content in PP. Compression molding of MPP resulted in an increase in protein cross-linking and improved maximum stress and extensibility as compared to PP at 130 degrees C. The highest degree of cross-linking with improved maximum stress and extensibility was found for WG/MPP blends compared to WG/PP and MWG/MPP at 130 degrees C. To conclude, chemical modification of PP changed the protein structures produced under harsh industrial conditions and made the protein more reactive and attractive for use in bio-based materials processing, no such positive gains were seen for WG.

  • 330.
    Munir, Arooj
    et al.
    Univ Bergen, Ctr Clin Dent Res, Dept Clin Dent, Fac Med, N-5009 Bergen, Norway..
    Doskeland, Anne
    Univ Bergen, Dept Biomed, Bergen, Norway..
    Avery, Steven J.
    Cardiff Univ, Dept Oral & Biomed Sci, Sch Dent, Cardiff, S Glam, Wales.;CITER, Cardiff, S Glam, Wales..
    Fuoco, Tiziana
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Mohamed-Ahmed, Samih
    Univ Bergen, Ctr Clin Dent Res, Dept Clin Dent, Fac Med, N-5009 Bergen, Norway..
    Lygre, Henning
    Univ Bergen, Ctr Clin Dent Res, Dept Clin Dent, Fac Med, N-5009 Bergen, Norway..
    Finne Wistrand, Anna
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH Royal Inst Technol, sDept Fibre & Polymer Technol, Stockholm, Sweden..
    Sloan, Alastair J.
    Cardiff Univ, Dept Oral & Biomed Sci, Sch Dent, Cardiff, S Glam, Wales.;CITER, Cardiff, S Glam, Wales..
    Waddington, Rachel J.
    Cardiff Univ, Dept Oral & Biomed Sci, Sch Dent, Cardiff, S Glam, Wales.;CITER, Cardiff, S Glam, Wales..
    Mustafa, Kamal
    Univ Bergen, Ctr Clin Dent Res, Dept Clin Dent, Fac Med, N-5009 Bergen, Norway..
    Suliman, Salwa
    Univ Bergen, Ctr Clin Dent Res, Dept Clin Dent, Fac Med, N-5009 Bergen, Norway..
    Efficacy of copolymer scaffolds delivering human demineralised dentine matrix for bone regeneration2019Ingår i: Journal of Tissue Engineering, ISSN 2041-7314, E-ISSN 2041-7314, Vol. 10, artikel-id 2041731419852703Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Poly(L-lactide-co-epsilon-caprolactone) scaffolds were functionalised by 10 or 20 mu g/mL of human demineralised dentine matrix. Release kinetics up to 21 days and their osteogenic potential on human bone marrow stromal cells after 7 and 21 days were studied. A total of 390 proteins were identified by mass spectrometry. Bone regeneration proteins showed initial burst of release. Human bone marrow stromal cells were cultured on scaffolds physisorbed with 20 mu g/mL and cultured in basal medium (DDM group) or physisorbed and cultured in osteogenic medium or cultured on non-functionalised scaffolds in osteogenic medium. The human bone marrow stromal cells proliferated less in demineralised dentine matrix group and activated ERK/1/2 after both time points. Cells on DDM group showed highest expression of IL-6 and IL-8 at 7 days and expressed higher collagen type 1 alpha 2, SPP1 and bone morphogenetic protein-2 until 21 days. Extracellular protein revealed higher collagen type 1 and bone morphogenetic protein-2 at 21 days in demineralised dentine matrix group. Cells on DDM group showed signs of mineralisation. The functionalised scaffolds were able to stimulate osteogenic differentiation of human bone marrow stromal cells.

  • 331.
    Mushi, Ngesa Ezekiel
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. Department of Mechanical and Industrial Engineering, College of Engineering and Technology, University of Dar Es Salaam, Dar es Salaam, Tanzania.
    Nishino, Takashi
    Kobe Univ, Dept Chem Sci & Engn, Kobe, Hyogo 6578501, Japan..
    Berglund, Lars A.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Zhou, Qi
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Kemi, Glykovetenskap. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Strong and Tough Chitin Film from alpha-Chitin Nanofibers Prepared by High Pressure Homogenization and Chitosan Addition2019Ingår i: ACS Sustainable Chemistry and Engineering, ISSN 2168-0485, Vol. 7, nr 1, s. 1692-1697Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Chitin nanofibers are an interesting biological nanomaterial for advanced applications, for example, in medicine, electronics, packaging and water purification. The challenge is to separate chitin nanofibers from protein in the exoskeleton structure of arthropods and avoid nanofibril aggregation to realize the mechanical potential of chitin. In this work, we developed a new method for the preparation of chitin nanofibers from lobster shell exoskeleton using 10 wt % chitosan as a sacrificial polymer. The addition of chitosan in the raw chitin colloidal suspension during high pressure homogenization process at pH 3 significantly reduced the agglomeration of chitin nanofibers as revealed by dynamic light scattering and transmission electron microscopy. Chitin film prepared from the chitin nanofiber suspension by vacuum filtration exhibited a true nanofibrils network structure without fibril aggregations as characterized by scanning electron microscopy. The presence of chitosan not only improves the colloidal stability of chitin nanofibers suspension but also facilitates the formation of chitin nanofiber network structure in the film as indicated by wide-angle X-ray diffraction analysis. The chitin nanofiber film with 4 +/- 1 wt % residual chitosan showed high tensile strength (187.2 +/- 5.6 MPa) and high work of fracture (12.1 +/- 0.4 MJ/m(3)), much higher than those chitin and chitosan films reported previously in the literature.

  • 332.
    Mystek, Katarzyna
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi.
    Larsson, Per
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi.
    Svagan, Anna Justina
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Wågberg, Lars
    KTH, Skolan för teknikvetenskap (SCI), Centra, VinnExcellens Centrum BiMaC Innovation. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi. KTH Royal Inst Technol, Fibre & Polymer Technol, Stockholm, Sweden..
    Wet-expandable cellulose-based capsules2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 333. Müller, C.
    et al.
    Ouyang, Liangqi
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi.
    Lund, A.
    Moth-Poulsen, K.
    Hamedi, Mahiar
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi.
    From Single Molecules to Thin Film Electronics, Nanofibers, e-Textiles and Power Cables: Bridging Length Scales with Organic Semiconductors2019Ingår i: Advanced Materials, artikel-id 1807286Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Organic semiconductors are the centerpiece of several vibrant research fields from single-molecule to organic electronics, and they are finding increasing use in bioelectronics and even classical polymer technology. The versatile chemistry and broad range of electronic functionalities of conjugated materials enable the bridging of length scales 15 orders of magnitude apart, ranging from a single nanometer (10 −9 m) to the size of continents (10 6 m). This work provides a taste of the diverse applications that can be realized with organic semiconductors. The reader will embark on a journey from single molecular junctions to thin film organic electronics, supramolecular assemblies, biomaterials such as amyloid fibrils and nanofibrillated cellulose, conducting fibers and yarns for e-textiles, and finally to power cables that shuffle power across thousands of kilometers.

  • 334.
    Nakamura, Keisuke
    et al.
    Tohoku Univ, Dept Adv Free Rad Sci, Grad Sch Dent, Aoba Ku, 4-1 Seiryo Machi, Sendai, Miyagi 9808575, Japan..
    Ankyu, Shuhei
    Sweden Dent Sendai, Miyagino Ku, 1-6-2 Tsutsujigaoka, Sendai, Miyagi 9830852, Japan..
    Nilsson, Fritjof
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymera material.
    Kanno, Taro
    Tohoku Univ, Dept Adv Free Rad Sci, Grad Sch Dent, Aoba Ku, 4-1 Seiryo Machi, Sendai, Miyagi 9808575, Japan..
    Niwano, Yoshimi
    Shumei Univ, Fac Nursing, 1-1 Daigaku Cho, Yachiyo, Chiba 2760003, Japan..
    von Steyern, Per Vult
    Malmo Univ, Fac Odontol, Dept Mat Sci & Technol, SE-20506 Malmo, Sweden..
    Örtengren, Ulf
    Univ Gothenburg, Sahlgrenska Acad, Inst Odontol, Dept Cariol, SE-40530 Gothenburg, Sweden.;Arctic Univ Norway, Fac Hlth Sci, Dept Clin Dent, N-9037 Tromso, Norway..
    Critical considerations on load-to-failure test for monolithic zirconia molar crowns2018Ingår i: Journal of The Mechanical Behavior of Biomedical Materials, ISSN 1751-6161, E-ISSN 1878-0180, Vol. 87, s. 180-189Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Application of monolithic zirconia crowns (MZCs) with reduced thickness to the molar region has been proposed, but potential complications have yet to be fully evaluated in laboratory tests. The present study aimed to develop a clinically relevant load-to-failure test in combination with fatigue treatments involving thermal and mechanical cycling (TC and MC) to evaluate the fracture resistance of molar MZCs. MZCs with a minimal thickness of 0.5 mm were bonded to dies made of resin-based composite (RBC), epoxy resin (EP), or polyoxymethylene-copolymer (POM-C). The samples were either untreated (UT) or subjected to TC (5-55 degrees C for 1 x 10(5) cycles) and MC (300 N for 2.4 x 10(6) cycles). The stress generated by TC and MC was simulated by finite element modeling. The load-to-failure test was performed using an inverse V-shaped two-plane indenter and was followed by fractographic analysis. The median values of fracture load for MZC/RBC and MZC/EP in the TC group were significantly lower than those in the UT group. MC also decreased the median value of fracture load for MZC/RBC significantly, but not that for MZC/EP and MZC/POM-C. Fractography revealed that the fracture started in the cervical area in all groups, which is similar to clinically failed crowns. The simulation confirmed stress concentration at the cervical area in both TC and MC groups. The present study suggests that the load-to-failure test using a two-plane indenter could induce clinically relevant fracture of MZCs, the vulnerability of the MZCs depends largely on the die material employed, and MZCs are more likely to be damaged by thermal fatigue than mechanical fatigue.

  • 335.
    Nameer, Samer
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. Royal Institute of Technology.
    Exploring fatty acid derivatives from renewable resources as raw materials for coating applications2019Doktorsavhandling, sammanläggning (Övrigt vetenskapligt)
    Abstract [sv]

    I arbetet som presenteras i denna avhandling undersöktes epoxifettsyraderivat vid bildandet av härdplaster för ytmodifieringsapplikationer. Förnybara råvarorna björkbark och epoxiderad linolja andändes för att erhålla epoxifettsyraderivaten. Björkbarken användes för att isolera 9,10-epoxi-18-hydroxidekansyra (EFA) och epoxoderad linolja användes för att extrahera metylstearat och 3 olika epoximetylestrar: epoximetyl oleat/linoleat/linolenat (EMO/EMLO/EMLEN). Epoxifettsyraderivaten användes i olika hartsformuleringar tillammans med andra reaktanter eller vid syntes av multifunktionella oligomerhartser med hjälp av enzymatisk katalys. Med hjälp av olika polymerisationstekniker så härdades alla hartser till härdplaster med en mängd olika egenskaper.Multifunktionella oligomerhartser syntetiserades med hjälp av enzymet Candida Antarctica lipas-b (CALB). Syntesen visade sig vara effektiv och oligomererna erhölls från en sats. Dessutom var selektiviteten hos CALB användbar för att bevara en mängd olika funktionella grupper (epoxider, alkener och tioler) i de slutliga oligomererna. Tiol-ene kemi eller katjonisk polymerisation användes sedan för att härda oligomererna, vilket resulterade i funktionella härdplaster. Vidare visades att ytegenskaperna kunde ändras genom möjlighet till funktionalisering av härdplasterna.Mjuka material återfås då man härdar rena fettsyrametylestrar. Ett sätt att öka de termiska och mekaniska egenskaperna undersöktes. De tre olika epoxifunktionella metylestrarna tillsammans med furan-2,5-dicarboxylsyraderivat blandades i hartser och härdades. Genom att variera de stökiometriska förhållanderna av reaktanterna så erhölls glastemperaturer (Tg) under 0°C och över 100 °C.Undersökningen av termisk härdning av EFA som ett komponentssystem studerades genom modelstudier. Studierna visade att en självkatalyserad process sker då EFA värms upp. Detta leder således till att EFA kan termiskt härda utan behov av en tillsatt katalysator. Dessutom uppvisade härdplasten limegenskaper.Rå blandning innehållande metylstearate, EMO, EMLO och EMLEN som erhölls från epoxiderad linolja undersöktes som en reaktiv utspädare i spolbeläggningar. Blandningen jämfördes även med kommersiellt tillgängliga utspädare så som fettsyrametylestrar (FAME) erhållna från rapsolja. De erhållna resultaten påvisade att fler feta metylestrar kunde integreras i slutliga beläggningen när fettsyraderivat från epoxideradlinolja användes.Realtids Fourier-transform infrarödspektroskopi (RT-FTIR) användes under det mesta av arbetet som presenteras i denna avhandling. RT-FTIR visade sig vara ett kraftfullt vektyg för att övervaka de olika reaktionerna samt jämföra relativa reaktionshastigheter.

    Publikationen är tillgänglig i fulltext från 2020-05-01 10:00
  • 336.
    Nameer, Samer
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik. Royal Institute of Technology.
    Deltin, Tomas
    PTE Coatings AB, SE-594 31, Gamleby, Sweden.
    Sundell, Per-Erik
    SSAB EMEA, SE-781 84, Borlänge, Sweden.
    Johansson, Mats
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Bio-based multifunctional fatty acid methyl esters as reactive diluents in coil coatingsManuskript (preprint) (Övrigt vetenskapligt)
  • 337.
    Nameer, Samer
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Larsen, Daniel B.
    Tech Univ Denmark, Dept Chem & Biochem Engn, DPC, Soltofts Plads Bldg 227, DK-2800 Lyngby, Denmark.;Tech Univ Denmark, Dept Chem, Bygning 207, DK-2800 Lyngby, Denmark..
    Duus, Jens O.
    Tech Univ Denmark, Dept Chem, Bygning 207, DK-2800 Lyngby, Denmark..
    Daugaard, Anders E.
    Tech Univ Denmark, Dept Chem & Biochem Engn, DPC, Soltofts Plads Bldg 227, DK-2800 Lyngby, Denmark..
    Johansson, Mats
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Biobased Cationically Polymerizable Epoxy Thermosets from Furan and Fatty Acid Derivatives2018Ingår i: ACS Sustainable Chemistry and Engineering, ISSN 2168-0485, Vol. 6, nr 7, s. 9442-9450Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    In the pursuit of environmentally friendly building blocks in polymer chemistry the utilization of biobased monomers is highly desired. In the present study, the biobased monomer 2,5-furandicarboxylic acid (FDCA) has been extended into epoxy thermosets. The study presents the synthesis of diallyl furan-2,5-dicarboxylate (DAFDC) followed by an epoxidation of the allyls to form diglycidyl furan-2,5-dicarboxylate (DGFDC). DGFDC was then copolymerized in both stoichiometric and off-stoichiometric ratios with epoxidized fatty methyl esters to form a range of thermosets. The cross-linking reaction was either thermally or UV-induced cationic polymerization utilizing onium salt initiators where the reactivity was studied by DSC and real-time fourier transform infrared analysis. Furthermore, the structure-property relationships of the final thermosets were determined by dynamic mechanical thermal analysis revealing a possibility to tune the properties over a wide range. In addition thermosets were made from diglycidyl Bisphenol-A (DGEBA) with epoxidized fatty methyl esters made for comparative purposes.

  • 338.
    Nameer, Samer
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Larsen, Daniel
    Tech Univ Denmark, Dept Chem, Copenhagen, Denmark.;Tech Univ Denmark, Dept Biochem Engn, Copenhagen, Denmark..
    Johansson, Mats
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Bio-based epoxy thermosets from fatty acid derivatives2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 339.
    Nilsson, Fritjof
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Moyassari, Ali
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Bautista, Angela
    E2F, Plaza Benjamin Palencia 2-3,Entreplata 5, Albacete 02006, Spain..
    Castro, Abraham
    E2F, Plaza Benjamin Palencia 2-3,Entreplata 5, Albacete 02006, Spain..
    Arbeloa, Ignacio
    Amayuelas SL, C Orense 27,Esc B 5 Drch, Madrid 28020, Spain..
    Jarn, Mikael
    RISE Res Inst Sweden, Div Biosci & Mat, Box 5607, SE-11486 Stockholm, Sweden..
    Lundgren, Urban
    RISE Res Inst Sweden, Div Safety & Transport, Elect, Brinellgatan 4,Box 857, SE-50115 Boras, Sweden..
    Welinder, Jan
    RISE Res Inst Sweden, Div Safety & Transport, Elect, Brinellgatan 4,Box 857, SE-50115 Boras, Sweden..
    Johansson, Kenth
    RISE Res Inst Sweden, Div Biosci & Mat, Box 5607, SE-11486 Stockholm, Sweden..
    Modelling anti-icing of railway overhead catenary wires by resistive heating2019Ingår i: International Journal of Heat and Mass Transfer, ISSN 0017-9310, E-ISSN 1879-2189, Vol. 143, artikel-id 118505Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Aggregation of ice on electrical cables and apparatus can cause severe equipment malfunction and is thus considered as a serious problem, especially in arctic climate zones. In particular, cable damage caused by ice accumulation on railway catenary wires is in wintertime a common origin for delayed trains in the northern parts of Europe. This study examines how resistive heating can be used for preventing formation of ice on metallic, non-insulated electrical cables. The heat equation and the Navier Stokes equations were solved simultaneously with FEM in 3D in order to predict the cable temperature as function of external temperature, applied voltage, wind speed, wind direction, and heating time. An analytical expression for the heat transfer coefficient was derived from the FEM simulations and it was concluded that the influence of wind direction can typically be neglected. Experimental validation measurements were performed on Kanthal cables in a climate chamber, giving temperature increase results in good agreement with the simulation predictions. The resistive heating efficiency, i.e. the ratio between applied electrical energy and resulting thermal energy, was found to be approximately 68% in this particular study.

  • 340.
    Niskanen, Ilpo
    et al.
    Univ Oulu, Fac Technol Struct & Construct Technol, POB 7300, FI-90014 Oulu, Finland. iskanen, Ilpo; Zakrisson, Daniel; Reza, Salim; Fedorov, Igor; Thungstrom, Goran.
    Forsberg, Viviane
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. Mid Sweden Univ, Dept Nat Sci, Holmgatan 10, SE-85170 Sundsvall, Sweden.
    Zakrisson, Daniel
    Reza, Salim
    Hummmelgård, Magnus
    Andres, Britta
    Federov, Igor
    Suopajärvi, Terhi
    Liimatainen, Henrikki
    Thungström, Göran
    Determination of nanoparticle size using Rayleigh approximation and Mie theory2019Ingår i: Chemical Engineering Science, ISSN 0009-2509, E-ISSN 1873-4405, Vol. 201, s. 222-229Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Accurate determination of the size of nanoparticles has an important role in many different scientific and industrial purposes, such as in material, medical and environment sciences, colloidal chemistry and astrophysics. We describe an effective optical method to determine the size of nanoparticles by analysis of transmission and scattering of visible spectral range data from a designed UV-Vis multi-spectrophotometer. The size of the nanoparticles was calculated from the extinction cross section of the particles using Rayleigh approximation and Mie theory. We validated the method using polystyrene nanospheres, cellulose nanofibrils, and cellulose nanocrystals. A good agreement was achieved through graphical analysis between measured extinction cross section values and theoretical Rayleigh approximation and Mie theory predictions for the sizes of polystyrene nanospheres at wavelength range 450-750 nm. Provided that Rayleigh approximation's forward scattering (FS)/back scattering (BS) ratio was smaller than 1.3 and Mie theory's FS/BS ratio was smaller than 1.8. A good fit for the hydrodynamic diameter of nanocellulose was achieved using the Mie theory and Rayleigh approximation. However, due to the high aspect ratio of nanocellulose, the obtained results do not directly reflect the actual cross-sectional diameters of the nanocellulose. Overall, the method is a fast, relatively easy, and simple technique to determine the size of a particle by a spectrophotometer. Consequently, the method can be utilized for example in production and quality control purposes as well as for research and development applications.

  • 341.
    Nordenström, Malin
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Nystrom, Gustav
    Empa, Lab Appl Wood Mat, Dubendorf, Switzerland..
    Fall, Andreas
    Res Inst Sweden, RISE, Bioecon, Stockholm, Sweden..
    Wågberg, Lars
    KTH, Skolan för teknikvetenskap (SCI), Centra, VinnExcellens Centrum BiMaC Innovation. KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Colloidal gels and glasses from nanocelluloses2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 342.
    Nordenström, Malin
    et al.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Riazanova, Anastasia
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Järn, Mikael
    RISE Res Inst Sweden, Div Biosci & Mat, SE-11428 Stockholm, Sweden..
    Paulraj, Thomas
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Turner, Charlotta
    Lund Univ, Dept Chem, SE-22100 Lund, Sweden..
    Ström, Valter
    KTH, Skolan för industriell teknik och management (ITM), Materialvetenskap.
    Olsson, Richard
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Svagan, Anna
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Superamphiphobic coatings based on liquid-core microcapsules with engineered capsule walls and functionality2018Ingår i: Scientific Reports, ISSN 2045-2322, E-ISSN 2045-2322, Vol. 8, artikel-id 3647Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Microcapsules with specific functional properties, related to the capsule wall and core, are highly desired in a number of applications. In this study, hybrid cellulose microcapsules (1.2 +/- 0.4 mu m in diameter) were prepared by nanoengineering the outer walls of precursor capsules. Depending on the preparation route, capsules with different surface roughness (raspberry or broccoli-like), and thereby different wetting properties, could be obtained. The tunable surface roughness was achieved as a result of the chemical and structural properties of the outer wall of a precursor capsule, which combined with a new processing route allowed in-situ formation of silica nanoparticles (30-40 nm or 70 nm in diameter). By coating glass slides with "broccoli-like" microcapsules (30-40 nm silica nanoparticles), static contact angles above 150 degrees and roll-off angles below 6 degrees were obtained for both water and low surface-tension oil (hexadecane), rendering the substrate superamphiphobic. As a comparison, coatings from raspberry-like capsules were only strongly oleophobic and hydrophobic. The liquid-core of the capsules opens great opportunities to incorporate different functionalities and here hydrophobic superparamagnetic nanoparticles (SPIONs) were encapsulated. As a result, magnetic broccoli-like microcapsules formed an excellent superamphiphobic coating-layer on a curved geometry by simply applying an external magnetic field.

  • 343.
    Nordstrom, Randi
    et al.
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Singh, Shalini
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden.;Univ Copenhagen, Bispebjerg Hosp, Wound Healing Ctr, Dept Biomed Sci, DK-2200 Copenhagen, Denmark..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.;Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark..
    Degradable dendritic nanogels as carriers for antimicrobial peptides2019Ingår i: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 554, s. 592-602Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPS). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40-60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 mu M.

  • 344.
    Nordström, Randi
    et al.
    Ms, Dept Pharm, Uppsala, Sweden..
    Nyström, Lina
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Umerska, Anita
    MINT Univ Angers, Angers, France..
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Poly(acrylic acid) microgels as carriers for antimicrobial peptides2018Ingår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Artikel i tidskrift (Övrigt vetenskapligt)
  • 345.
    Norström, Emelie
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hemicelluloses and other Polysaccharides for Wood Adhesive Applications2018Doktorsavhandling, sammanläggning (Övrigt vetenskapligt)
    Abstract [en]

    The growing environmental awareness has led to an increased interest in bio-based polymers as replacement for fossil-based materials. The purpose of the work described in this thesis was to investigate the possibility of using hemicelluloses and other polysaccharides as replacement for fossil-based polymers in wood adhesives. Together with cellulose and lignin, hemicellulose is the main constituent of wood. In the pulp industry, significant amounts of hemicelluloses are obtained as by-products and combusted for energy recovery, but there is a growing interest in the biorefinery concept where all side-streams are utilized. If valuable applications, such as adhesives, of hemicelluloses and other by-products are found, large amounts can be obtained from the pulp industry. Water dispersions of hemicelluloses and other polysaccharides have been prepared and evaluated as adhesives for bonding different wood substrates together. The dry bond strength, water resistance, and heat resistance were investigated by exposing the bonded wood specimens to different conditioning methods and thereafter measuring the tensile shear strengths. As a replacement, the bio-based wood adhesive must possess similar or even better properties than the fossil-based adhesives. A commercial poly(vinyl acetate) (PVAc) wood adhesive used for indoor applications has been used as a reference benchmark. Wood hemicelluloses themselves do not have sufficient bonding performance probably because their low molecular weight does not provide adequate strength and makes the adhesive too brittle. The addition of dispersing agents and crosslinkers to the hemicellulose dispersions can significantly improve the bonding performance, and hemicellulose in combination with poly(vinyl amine) showed promising results superior those of PVAc. A fully bio-based adhesive comprising of hemicellulose and chitosan, another bio-based polysaccharide, obtain surprisingly good bonding performance especially with regard to water resistance. Gums, polysaccharides with similar structures to those of hemicelluloses but with higher molecular weights, have also been studied and locust bean gum dispersions without any modification showed a very good bonding performance with high dry bond strength and water resistance on a par with those of PVAc and a heat resistance superior to that of PVAc. Chitosan has very good adhesive properties especially with regard to water resistance, but the high viscosity of the chitosan dispersion makes it difficult to apply. Chitosan-grafted-PVAc dispersions were therefore prepared and an adhesive very similar in appearance to PVAc was obtained with a good bonding performance as well as good applicability.

  • 346.
    Odelius, Karin
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymerteknologi.
    Design of renewable polymeric materials through ring-opening reactions2018Ingår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 256Artikel i tidskrift (Övrigt vetenskapligt)
  • 347.
    Odelius, Karin
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Ring-opening reactions to functional polyamides and polyurethanes2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
  • 348.
    Ogonowski, Martin
    et al.
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Edlund, Ulrica
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Gorokhova, Elena
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Linde, Margareta
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Ek, Karin
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Liewenborg, Birgitta
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Konnecke, Oda
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Navarro, Julien R. G.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Breitholtz, Magnus
    Stockholm Univ, Dept Environm Sci & Analyt Chem, Svante Arrhenius Vag 8, S-11418 Stockholm, Sweden..
    Multi-level toxicity assessment of engineered cellulose nanofibrils in Daphnia magna2018Ingår i: Nanotoxicology, ISSN 1743-5390, E-ISSN 1743-5404, Vol. 12, nr 6, s. 509-521Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    Cellulose nanofibril (CNF)-based materials are increasingly used in industrial and commercial applications. However, the impacts of CNF on aquatic life are poorly understood, and there are concerns regarding their potential toxicity. Using a combination of standard ecotoxicological tests and feeding experiments, we assessed the effects of CNF exposure (0.206-20.6 mg/L) on the feeding (food uptake and gut residence time) and life-history traits (growth and reproduction) in the cladoceran Daphnia magna. No mortality was observed in a 48 h acute exposure at 2060 mg/L. Moreover, a 21-day exposure at low food and moderate CNF levels induced a stimulatory effect on growth, likely driven by increased filtration efficiency, and, possibly, partial assimilation of the CNF by the animals. However, at low food levels and the highest CNF concentrations, growth and reproduction were negatively affected. These responses were linked to caloric restriction caused by dilution of the food source, but not an obstruction of the alimentary canal. Finally, no apparent translocation of CNF past the alimentary canal was detected. We conclude that CNF displays a low toxic potential to filter-feeding organisms and the expected environmental risks are low.

  • 349. Ohm, Wiebke
    et al.
    Rothkirch, Andre
    Pandit, Pallavi
    Koerstgens, Volker
    Mueller-Buschbaum, Peter
    Rojas, Ramiro
    Yu, Shun
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Polymerteknologi.
    Brett, Calvin J.
    Soderberg, Daniel L.
    Roth, Stephan V.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer.
    Morphological properties of airbrush spray-deposited enzymatic cellulose thin films2018Ingår i: JOURNAL OF COATINGS TECHNOLOGY AND RESEARCH, ISSN 1945-9645, Vol. 15, nr 4, s. 759-769Artikel i tidskrift (Refereegranskat)
    Abstract [en]

    We investigate the layer formation of enzymatic cellulose by airbrush spray coating on silicon oxide surfaces. The layer structure and morphology of enzymatic cellulose films in the thickness range between 86 nm and 2.1 A mu m is determined as a function of the spray coating procedures. For each spray coating step, layer buildup, surface topography, crystallinity as well as the nanoscale structure are probed with atomic force microscopy and surface-sensitive X-ray scattering methods. Without intermittent drying, the film thickness saturates; with intermittent drying, a linear increase in layer thickness with the number of spray pulses is observed. A closed cellulose layer was always observed. The crystallinity remains unchanged; the nanoscale structures show three distinct sizes. Our results indicate that the smallest building blocks increasingly contribute to the morphology inside the cellulose network for thicker films, showing the importance of tailoring the cellulose nanofibrils. For a layer-by-layer coating, intermittent drying is mandatory.

  • 350.
    Ohm, Wiebke
    et al.
    DESY, Hamburg, Germany..
    Rothkirch, Andre
    DESY, Hamburg, Germany..
    Pandit, Pallavi
    DESY, Hamburg, Germany..
    Koerstgens, Volker
    Tech Univ Munich, Garching, Germany..
    Mueller-Buschbaum, Peter
    Tech Univ Munich, Garching, Germany..
    Rojas, Ramiro
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center.
    Yu, Shun
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Fiberteknologi.
    Brett, Calvin
    KTH, Skolan för teknikvetenskap (SCI), Mekanik, Strömningsfysik.
    Söderberg, Daniel
    KTH, Skolan för teknikvetenskap (SCI), Centra, Linné Flow Center, FLOW. KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Centra, Wallenberg Wood Science Center. KTH, Skolan för teknikvetenskap (SCI), Mekanik, Strömningsfysik.
    Roth, Stephan V.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Biokompositer. DESY, Hamburg, Germany..
    Morphological and crystalline properties of airbrush spray-deposited enzymatic cellulose thin films2019Ingår i: Abstracts of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 257Artikel i tidskrift (Övrigt vetenskapligt)
45678910 301 - 350 av 512
RefereraExporteraLänk till träfflistan
Permanent länk
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annat format
Fler format
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
  • html
  • text
  • asciidoc
  • rtf