Change search
Refine search result
123 51 - 100 of 136
CiteExportLink to result list
Permanent link
Cite
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Rows per page
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
Sort
  • Standard (Relevance)
  • Author A-Ö
  • Author Ö-A
  • Title A-Ö
  • Title Ö-A
  • Publication type A-Ö
  • Publication type Ö-A
  • Issued (Oldest first)
  • Issued (Newest first)
  • Created (Oldest first)
  • Created (Newest first)
  • Last updated (Oldest first)
  • Last updated (Newest first)
  • Disputation date (earliest first)
  • Disputation date (latest first)
  • Standard (Relevance)
  • Author A-Ö
  • Author Ö-A
  • Title A-Ö
  • Title Ö-A
  • Publication type A-Ö
  • Publication type Ö-A
  • Issued (Oldest first)
  • Issued (Newest first)
  • Created (Oldest first)
  • Created (Newest first)
  • Last updated (Oldest first)
  • Last updated (Newest first)
  • Disputation date (earliest first)
  • Disputation date (latest first)
Select
The maximal number of hits you can export is 250. When you want to export more records please use the Create feeds function.
  • 51. Kang, Taegon
    et al.
    Amir, Roey J.
    Khan, Anzar
    Ohshimizu, Kaoru
    Hunt, Jasmine N.
    Sivanandan, Kulandaivelu
    Montanez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Ueda, Mitsuru
    Hawker, Craig J.
    Facile access to internally functionalized dendrimers through efficient and orthogonal click reactions2010In: Chemical Communications, ISSN 1359-7345, E-ISSN 1364-548X, Vol. 46, no 9, p. 1556-1558Article in journal (Refereed)
    Abstract [en]

    A simple synthetic strategy has been developed for accessing internally functionalized dendrimers. The key feature of this approach is the use of two orthogonal and efficient reactions` epoxy-amine' and 'thiol-ene' coupling-for rapid growth of the dendritic scaffold. This sequence of reactions allows for the introduction of reactive hydroxyl groups at each dendritic layer.

  • 52. Khan, Anzar
    et al.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Montague, Martha F.
    Hawker, Craig J.
    Synthesis and characterization of hyperbranched polymers with increased chemical versatility for imprint lithographic resists2008In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 46, no 18, p. 6238-6254Article in journal (Refereed)
    Abstract [en]

    Hyperbranched polymers were prepared from a variety of mono- and difunctional monomers and used in the development of novel UV-imprint lithography (UV-IL) resists. The unique physical and chemical properties of these hyperbranched materials significantly increase the range of molecular systems that could be imprinted. Traditional challenges, such as the use of monomers that have low boiling points or the use of insoluble/highly crystalline momomers, are overcome by the preparation of hyperbranched polymers that incorporate these repeat units. In addition, the low viscosity of the hyperbranched macromolecules and the large number of reactive chain ends overcome many difficulties that are traditionally associated with the use of polymeric materials as imprint resists. Hyperbranched polymers containing up to 12 mol % pendant vinyl groups, needed for secondary crosslinking during imprinting, were prepared with a wide range of repeat unit structures and successfully imprinted with features from tens of microns to similar to 100 nm.

  • 53. Kikionis, Stefanos
    et al.
    Ioannou, Efstathia
    Andrén, Oliver C. J.
    Chronakis, Ioannis S.
    Fahmi, Amir
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Toskas, Georgios
    Roussis, Vassilios
    Nanofibrous nonwovens based on dendritic-linear-dendritic poly(ethylene glycol) hybrids2018In: Journal of Applied Polymer Science, ISSN 0021-8995, E-ISSN 1097-4628, Vol. 135, no 10, article id 45949Article in journal (Refereed)
    Abstract [en]

    Dendritic-linear-dendritic (DLD) hybrids are highly functional materials combining the properties of linear and dendritic polymers. Attempts to electrospin DLD polymers composed of hyperbranched dendritic blocks of 2,2-bis(hydroxymethyl) propionic acid on a linear poly(ethylene glycol) core proved unsuccessful. Nevertheless, when these DLD hybrids were blended with an array of different biodegradable polymers as entanglement enhancers, nanofibrous nonwovens were successfully prepared by electrospinning. The pseudogeneration degree of the DLDs, the nature of the co-electrospun polymer and the solvent systems used for the preparation of the electrospinning solutions exerted a significant effect on the diameter and morphology of the electrospun fibers. It is worth-noting that aqueous solutions of the DLD polymers and only 1% (w/v) poly(ethylene oxide) resulted in the production of smoother and thinner nanofibers. Such dendritic nanofibrous scaffolds can be promising materials for biomedical applications due to their bio-compatibility, biodegradability, multifunctionality, and advanced structural architecture.

  • 54.
    Larsson, Emma
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology. KTH, School of Engineering Sciences (SCI), Centres, VinnExcellence Center BiMaC Innovation.
    Ingverud, Tobias
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology. KTH, School of Chemical Science and Engineering (CHE), Centres, Wallenberg Wood Science Center.
    Hemmer, Guillaume
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Rojas, Ramiro
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology. KTH, School of Chemical Science and Engineering (CHE), Centres, Wallenberg Wood Science Center.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Carlmark, Anna
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology. KTH, School of Engineering Sciences (SCI), Centres, VinnExcellence Center BiMaC Innovation. KTH, School of Chemical Science and Engineering (CHE), Centres, Wallenberg Wood Science Center.
    Thermoresponsive hydrogels of cellulose nanofibrils and triblock copolymersManuscript (preprint) (Other academic)
    Abstract [en]

    Atom transfer radical polymerization (ATRP) has been utilized to synthesize triblock and star-block copolymers of quaternized poly(2-(dimethylamino)ethyl methacrylate) (qPDMAEMA) and poly(di(ethylene glycol) methyl ether methacrylate (PDEGMA). The block copolymers, that all contained a minimum of two charged blocks, were sequential adsorbed to negatively charged cellulose nanofibrils (CNF) in dilute water suspension, forming thermoresponsive hydrogels. The presence of more than one charge block allowed for the polymers to form permanent, physically crosslinked, gels when adsorbed to the CNF. The ability of the polymers to adsorb to CNF was confirmed by quartz crystal microbalance with dissipation monitoring (QCM-D), and the thermoresponsive properties of the gels were investigated by rheological measurements and gravimetric measurements. This method was shown to be promising for the facile, production of thermoresponsive hydrogels composed of CNF.

  • 55. Latorre-Sanchez, Alejandro
    et al.
    Johansson, Mats
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Zhang, Yuning
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Pomposo, Jose A.
    Active quinine-based films able to release antimicrobial compounds via melt quaternization at low temperature2018In: Journal of materials chemistry. B, ISSN 2050-750X, E-ISSN 2050-7518, Vol. 6, no 1, p. 98-104Article in journal (Refereed)
    Abstract [en]

    The fabrication of antibacterial films based on renewable materials (e.g., chitosan) has attracted significant interest in fields such as food packaging, health care and medicine. However, exploiting the antibacterial properties of cinchona alkaloids to design active nanostructured films able to release quinine-based antimicrobial compounds has not been considered previously. Herein, we develop two different routes to produce active quinine-based nanostructured cross-linked films by exploiting the multiple reactive sites of quinine and, specifically, both the nitrogen atom and the vinyl group of the quinuclidine portion of the molecule, as well as their corresponding orthogonal quaternization and thiol-ene coupling reactions. The first synthetic strategy produces stiff and brittle nanostructured quinine-based films of limited utility for practical applications. Conversely, the second approach produces active, flexible and nanostructured quinine-based films (T-g = - 14 degrees C, Young's modulus = 1.3 GPa), which are able to release antimicrobial compounds against E. coli that, remarkably, are noncytotoxic against mouse macrophage and human dermal fibroblast cells. These kinds of active cinchona alkaloid-based coatings are easy to prepare by means of simple, solvent-free, melt quaternization/spreading procedures at a relatively low temperature (120 degrees C), making this second approach one of the most facile reported procedures to date to produce active nanostructured bio-based films.

  • 56. Lo Conte, Mauro
    et al.
    Robb, Maxwell J.
    Hed, Yvonne
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Marra, Alberto
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hawker, Craig J.
    Dondoni, Alessandro
    Exhaustive Glycosylation, PEGylation, and Glutathionylation of a [G4]-ene(48) Dendrimer via Photoinduced Thiol-ene Coupling2011In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 49, no 20, p. 4468-4475Article in journal (Refereed)
    Abstract [en]

    The use of free-radical thiol-ene coupling (TEC) for the introduction of carbohydrate, poly(ethylene glycol), and peptide fragments at the periphery of an alkene functional dendrimer has been reported in this article. Four different sugar thiols including glucose, mannose, lactose, and sialic acid, two PEGylated thiols, and the natural tripeptide glutathione were reacted with a fourth generation alkene functional dendrimer [G4]-ene(48) on irradiation at lambda(max) 365 nm. In all cases, the (1)H NMR spectra of the crude reaction mixture revealed the complete disappearance of alkene proton signals indicating the quantitative conversion of all 48 alkene groups of the dendrimer. With one exception only, all dendrimer conjugates were isolated in high yields (70-94%), validating the high efficiency of multiple TEC reactions on a single substrate. All isolated and purified compounds were analyzed by matrix assisted laser desorption ionization-time of flight (MALDI-TOF) spectrometry and gave spectra consistent with the assigned structure.

  • 57. Long, David A.
    et al.
    Unal, Kerem
    Pratt, Russell C.
    Malkoch, Michael
    Frommer, Jane
    Localized "Click" chemistry through dip-pen nanolithography2007In: Advanced Materials, ISSN 0935-9648, E-ISSN 1521-4095, Vol. 19, no 24, p. 4471-+Article in journal (Refereed)
    Abstract [en]

    Local reactions are triggered by delivering molecules from an AFM probe tip, allowing for direct modification of chemically functionalized surfaces. Silicon wafer-bound acetylene moieties readily undergo 1,3-dipolar cycloadddition with solution-phase azides delivered from an AFM tip. This selective and robust technique allows for the facile creation and placement of sub-micrometer-sized features.

  • 58.
    Long, Hui
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Cellulose reinforced hydrogel via click chemistry2012In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 243Article in journal (Other academic)
  • 59.
    Lundberg, Pontus
    et al.
    KTH, School of Chemical Science and Engineering (CHE).
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE).
    Fogelström, Linda
    KTH, School of Chemical Science and Engineering (CHE).
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE).
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE).
    POLY 660-Controlled design of amphiphilic block-copolymers using ring-opening polymerization and click chemistry2007In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Article in journal (Other academic)
  • 60.
    Lundberg, Pontus
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Bruin, Anouk
    Klijnstra, Job W.
    Nyström, Andreas M.
    Johansson, Mats K. G.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Poly(ethylene glycol)-Based Thiol-ene Hydrogel Coatings-Curing Chemistry, Aqueous Stability, and Potential Marine Antifouling Applications2010In: ACS Applied Materials and Interfaces, ISSN 1944-8244, E-ISSN 1944-8252, Vol. 2, no 3, p. 903-912Article in journal (Refereed)
    Abstract [en]

    Photocured thiol-ene hydrogel coatings based on poly(ethylene glycol) (PEG) were investigated for marine antifouling purposes. By varying the PEG length, vinylic end-group, and thiol cross-linker, a library of hydrogel coatings with different structural composition was efficiently accomplished, with or without ester linkages. The thiol-methacrylate and thiol-allyl systems were evaluated with respect to curing, degradation, as well as antifouling properties. Moth acrylate-based systems exhibited homopolymerization, whereas allyl-based systems reacted more selectively through thiol-ene couplings reaction. The ester-free hydrogels elucidated higher hydrolytic stability whereas longer PEG chains accelerated the degradation process. The antifouling properties were evaluated by protein adsorption With Bovine serum albumin (BSA) and bioassays with the marine bacteria, Cobetia marina, and the marine diatom, Amphora coffeaeformis; in all tests, longer PEG lengths improved the antifouling properties.

  • 61.
    Lundberg, Pontus
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Daehne, Bernd
    Andrén, Oliver
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Laurin, Richard
    Watermann, Burkhard
    Lundin, Claes
    Johansson, Mats K. G.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Poly(ethylene glycol)-based thiol-ene hydrogels evaluated for their potential as antifouling coatings: Field studies and mechanical propertiesArticle in journal (Other academic)
  • 62. Lundberg, Pontus
    et al.
    Hawker, Craig J.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Click assisted one-pot multi-step reactions in polymer science: Accelerated synthetic Protocols2008In: Macromolecular rapid communications, ISSN 1022-1336, E-ISSN 1521-3927, Vol. 29, no 12-13, p. 998-1015Article, review/survey (Refereed)
    Abstract [en]

    Presently, the majority of reports deal with combining chemical reactions, in a stepwise fashion, to obtain well-defined polymers. In the future, chemists need to address new challenges such as increase in the range of available efficient reactions, developing libraries of compatible one-pot reactions, and the application of obtained materials in key industries. Indeed, the rising importance of the click concept has now devised robust synthetic approaches in various fields of research. The unique selectivity of the click reaction is today a new found toolbox for scientists to investigate one-pot multi-step systems. Several accelerated protocols have elegantly been reported to obtain a library of advanced polymers.

  • 63.
    Lundberg, Pontus
    et al.
    Univ Calif Santa Barbara, Mat Res Lab, Santa Barbara, USA.
    Lynd, Nathaniel A.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Nyström, Andreas M.
    Hawker, Craig J.
    Novel reversible hydrogels with pH-responsiveness at physiological pH2012In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 243Article in journal (Other academic)
  • 64. Lundberg, Pontus
    et al.
    Lynd, Nathaniel A.
    Zhang, Yuning
    Zeng, Xianghui
    Krogstad, Daniel V.
    Paffen, Tim
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Nyström, Andreas M.
    Hawker, Craig J.
    pH-triggered self-assembly of biocompatible histamine-functionalized triblock copolymers2013In: Soft Matter, ISSN 1744-683X, E-ISSN 1744-6848, Vol. 9, no 1, p. 82-89Article in journal (Refereed)
    Abstract [en]

    Histamine functionalized poly(allyl glycidyl ether)-b-poly(ethylene glycol)-b-poly(allyl glycidyl ether) (PAGE-PEO-PAGE) triblock copolymers represent a new class of physically cross-linked, pH-responsive hydrogels with significant potential for biomedical applications. These telechelic triblock copolymers exhibited abrupt and reversible hydrogelation above pH 7.0 due to a hydrophilic/hydrophobic transition of the histamine units to form a network of hydrophobic domains bridged by a hydrophilic PEO matrix. These hydrophobic domains displayed improved ordering upon increasing pH and self-assembled into a body centered cubic lattice at pH 8.0, while at lower concentrations formed well-defined micelles. Significantly, all materials were found to be non-toxic when evaluated on three different cell lines and suggests a range of medical and biomedical applications.

  • 65.
    Lundberg, Pontus
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Walter, Valérie Marie
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Montañez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Daniel
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Linear dendritic polymeric amphiphiles with intrinsic biocompatibility: synthesis and characterization to fabrication of micelles and honeycomb membranes2011In: Polymer Chemistry, ISSN 1759-9954, Vol. 2, p. 394-402Article in journal (Refereed)
    Abstract [en]

    Linear dendritic hybrid materials enable a range of architectural variations which offers novel possibilities in the tailoring of polymeric materials. In this study dendrons based on the 2,2-bis(methylol)propionic acid (bis-MPA) building block, bearing click chemistry moieties in the core and peripheral hydroxyl functionalities, have been used as macroinitiators for ring opening polymerization of ε-caprolactone. A library of star branched polymers with poly(ε-caprolactone) chains was initially constructed using dendrons up to 4th generation. In a second step, the popular CuAAC or thiol–ene click reaction was efficiently used to attach poly(ethylene glycol) chains of different lengths to the core. Potential applications of the resulted amphiphilic linear dendritic hybrids were investigated. Both self-assembled micelles loaded with doxorubicin anticancer drug and ordered honeycomb membranes with enhanced surface area were successfully fabricated and characterized.

  • 66. Lundgren, Anders
    et al.
    Hed, Yvonne
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Öberg, Kim
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Sellborn, Anders
    Fink, Helen
    Loewenhielm, Peter
    Kelly, Jonathan
    Malkoch, Michael
    Berglin, Mattias
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Self-Assembled Arrays of Dendrimer-Gold-Nanoparticle Hybrids for Functional Cell Studies2011In: Angewandte Chemie International Edition, ISSN 1433-7851, E-ISSN 1521-3773, Vol. 50, no 15, p. 3450-3453Article in journal (Refereed)
  • 67. Mahltig, Boris
    et al.
    Cheval, Nicolas
    Astachov, Vladimir
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Montanez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Haase, Hajo
    Fahmi, Amir
    Hydroxyl functional polyester dendrimers as stabilizing agent for preparation of colloidal silver particles-a study in respect to antimicrobial properties and toxicity against human cells2012In: Colloid and Polymer Science, ISSN 0303-402X, E-ISSN 1435-1536, Vol. 290, no 14, p. 1413-1421Article in journal (Refereed)
    Abstract [en]

    The presented study concerns the preparation and investigation of silver particles in presence of hydroxylated polyester dendrimers used as stabilizing agent. Altogether a full series of water soluble and aliphatic bis-MPA dendrimers from first to fifth generation was used as to stabilize silver nanoparticles in situ. A special focus is set on the biological properties. The antibacterial properties of the dendrimer stabilized silver particles are tested against Escherichia coli and the toxicity against human cells is tested with the human epithelial cell line A549. Under the chosen testing arrangement, it was observed that the silver particles contain a significant antibacterial effect against E. coli. Silver particles stabilized in situ with dendrimers of higher generation seem to contain a stronger antibacterial property. No toxicity against human cells was observed for the silver particles even in case of the highest investigated silver concentration. Altogether the here prepared and investigated silver particles could offer a great potential for application as antibacterial agent with low human toxicity.

  • 68.
    Malkoch, Michael
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology.
    Heterogeneous rupturing dendrimers2018In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 256Article in journal (Other academic)
  • 69.
    Malkoch, Michael
    KTH, Superseded Departments, Fibre and Polymer Technology.
    New approaches in synthesis and characterization of dendritic macromolecules based on bis-mpa2003Doctoral thesis, comprehensive summary (Other scientific)
  • 70.
    Malkoch, Michael
    et al.
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Carlmark, Anna
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Wodegiorgis, A
    Hult, Anders
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Malmström, Eva
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Dendronized aliphatic polymers by a combination of ATRP and divergent growth2004In: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 37, no 2, p. 322-329Article in journal (Refereed)
    Abstract [en]

    Dendronized, hybrid dendritic-linear polymers were synthesized by either the "graft-onto" route or by atom transfer radical polymerization (ATRP) of macromonomers. In both ways, the main chain was composed of acrylate repeating units and the dendrons were based on the aliphatic ester skeleton obtained from 2,2-bis(methylol)propionic acid (bis-MPA). ATRP of macromonomers was not a viable route for monomers with side chains larger than second-generation dendrons, which is why a combination of the two approaches was required to obtain polymers with larger side chains. The "graft-onto" route was conducted by reacting hydroxyl groups on the main chain with the acetonide-protected 2,2-bis(hydroxymethyl)propionic anhydride. The acetonide protecting group was easily removed by treating a solution of the polymer with an acidic ion-exchange resin. Dendronized polymers with 1-3 generation dendron side groups were synthesized with a maximum molecular weight of ca. 86 kDa. The products were analyzed by H-1 and C-13 NMR, SEC, and MALDI-TOF.

  • 71.
    Malkoch, Michael
    et al.
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Claesson, Hans
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Löwenhielm, Peter
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Malmström, Eva
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Hult, Anders
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Synthesis and characterization of 2,2-bis(methylol)propionic acid dendrimers with different cores and terminal groups2004In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 42, no 7, p. 1758-1767Article in journal (Refereed)
    Abstract [en]

    Three sets of aliphatic polyester dendrimers based on 2,2-bis(methylol)propionic acid (bis-MPA) were synthesized. Two of the sets had benzylidene terminal groups and either a trimethylolpropane or triphenolic core moiety. The last set had acetonide terminal groups and a triphenolic core moiety. Benzylidene-[G#1]-anhydride and acetonide-[G#1] -anhydride were used as the reactive building blocks in the construction of all dendrimers. The large excess of building blocks used in the coupling reactions initially resulted in considerable material loss. This waste was eliminated through the development of a recycling method. H-1 and C-13 NMR and matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) analysis were used to verify the purity of all compounds. Size exclusion chromatography (SEC) was used, as well as MALDI-TOF, for molecular weight determinations. The SEC measurements were conducted with a universal calibration method and an online right-angle laser light scattering detector. Measured dendrimer molecular weights were close to their theoretical molar masses. Observations were also made of the hydrodynamic radius and intrinsic viscosity for the different dendrimers.

  • 72.
    Malkoch, Michael
    et al.
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Hallman, Kristina
    KTH, Superseded Departments, Chemistry.
    Lutsenko, Serghey
    KTH, Superseded Departments, Chemistry.
    Hult, Anders
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Malmström, Eva
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Moberg, Christina
    KTH, Superseded Departments, Chemistry.
    Dendritic oxazoline ligands in enantioselective palladium-catalyzed allylic alkylations2002In: Journal of Organic Chemistry, ISSN 0022-3263, E-ISSN 1520-6904, Vol. 67, no 23, p. 8197-8202Article in journal (Refereed)
    Abstract [en]

    First to fourth generation dendritic substituents based on 2,2-bis(hydroxymethyl)propionic acid and (1R,2S,5R)-menthoxyacetic acid were attached to 2-(hydroxymethyl)pyridinooxazoline and his[4-(hydroxymethyl)oxazoline] compounds. The new ligands obtained were assessed in palladium-catalyzed allylic alkylations. The first type of ligands exhibited enantioselectivity similar to that of a benzoyl ester derivative, whereas the latter type of ligands afforded products with higher selectivity than the analogous benzoyl ester. The activity of the dendritic catalysts decreased with increasing generation.

  • 73.
    Malkoch, Michael
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malmström Jonsson, Eva
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Nyström, A. M.
    Dendrimers: Properties and Applications2012In: Polymer Science: A Comprehensive Reference, 10 Volume Set, Elsevier, 2012, Vol. 6, p. 113-176Chapter in book (Refereed)
    Abstract [en]

    This chapter provides a review of the use of various dendrimer families in drug-delivery applications. The first part gives a brief introduction to the field of dendrimer science, also covering the synthesis of the most commonly used dendrimers. The second part provides a description of the chemical, structural, and physical characterization of dendrimers along with a brief description of various techniques employed, with nuclear magnetic resonance, matrix-assisted laser desorption/ionization time-of-flight, and microscopy on dendrimers described in more detail. Special emphasis is given to highlight the interplay between chemical features (repeating unit, end groups, and size) and properties. The last part provides a more detailed and in-depth overview of various dendrimer-drug conjugates and their characteristics in drug-delivery aspects.

  • 74. Malkoch, Michael
    et al.
    Schleicher, K.
    Drockenmuller, E.
    Hawker, C. J.
    Russell, T. P.
    Wu, P.
    Fokin, V. V.
    Structurally diverse dendritic libraries: A highly efficient functionalization approach using Click chemistry2005In: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 38, no 9, p. 3663-3678Article in journal (Refereed)
    Abstract [en]

    The high fidelity and efficiency of Click chemistry are exploited in the synthesis of a library of chain end functionalized dendritic macromolecules. In this example, the selectivity of the Cu-catalyzed [3 + 2 pi] cycloaddition reaction of azides with terminal acetylenes, coupled with mild reaction conditions, permits unprecedented functional group tolerance during the derivatization of dendrimeric and hyperbranched scaffolds. The resulting dendritic libraries are structurally diverse, encompassing a variety of backbones/surface functional groups, and are prepared in almost quantitative yields under very mild conditions. The robust and simple nature of this procedure, combined with its applicability to many aspects of polymer synthesis and materials chemistry, demonstrates an evolving synergy between advanced organic chemistry and functional materials.

  • 75. Malkoch, Michael
    et al.
    Thibault, R. J.
    Drockenmuller, E.
    Messerschmidt, M.
    Voit, B.
    Russell, T. P.
    Hawker, C. J.
    Orthogonal approaches to the simultaneous and cascade functionalization of macromolecules using click chemistry2005In: Journal of the American Chemical Society, ISSN 0002-7863, E-ISSN 1520-5126, Vol. 127, no 42, p. 14942-14949Article in journal (Refereed)
    Abstract [en]

    The development of selective chemistries that are orthogonal to the diverse array of functional groups present in many polymeric systems is becoming an important tool for the synthesis and use of macromolecules in fields ranging from biomedical devices to nanotechnology. By combining copper-catalyzed cycloaddition chemistry with other synthetic transformations such as esterification, amidation, etc., highly efficient and modular simultaneous and cascade functionalization strategies have been developed. These single-step strategies for preparing multifunctional macromolecules represent a significant advance as compared to traditional multistep approaches, and the utility of these concepts is demonstrated by selective preparation of a diverse range of orthogonally functionalized vinyl polymers.

  • 76. Malkoch, Michael
    et al.
    Vestberg, Robert
    Gupta, Nalini
    Mespouille, Laetitia
    Dubois, Philipe
    Mason, Andrew F.
    Hedrick, James L.
    Liao, Qi
    Frank, Curtis W.
    Kingsbury, Kevin
    Hawker, Craig J.
    Synthesis of well-defined hydrogel networks using Click chemistry2006In: Chemical Communications, ISSN 1359-7345, E-ISSN 1364-548X, no 26, p. 2774-2776Article in journal (Refereed)
    Abstract [en]

    New PEG-based hydrogel materials have been synthesized by Click chemistry and shown to result in well-defined networks having significantly improved mechanical properties; the selectivity of the azide/ acetylene coupling reaction also allows for the incorporation of various additives and functional groups leading to chemical tailoring of the hydrogels.

  • 77.
    Malkoch, Michel
    et al.
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Malmström, Eva
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Hult, Anders
    KTH, Superseded Departments, Fibre and Polymer Technology.
    Rapid and efficient synthesis of aliphatic ester dendrons and dendrimers2002In: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 35, no 22, p. 8307-8314Article in journal (Refereed)
    Abstract [en]

    A divergent approach to synthesize dendritic aliphatic polyester structures based on 2,2-bis(hydroxymethyl) propionic acid (bis-MPA) is described. The key building block is the anhydride of isopropylidene-2,2-bis(methoxy) propionic acid which is synthesized in high yields through self-dehydration, utilizing N,N'-dicyclohexylcarbodiimide (DCC) as reagent. The high reactivity of the anhydride toward hydroxyl groups makes the divergent synthesis of dendrimers and dendrons viable. Dendritic growth occurs in the presence of protecting groups sensitive toward hydrogenolysis, such as benzyl esters and ethers. The acetonide-protecting group is easily removed under acidic conditions using DOWEX 50W-X2 resin in methanol. Fourth-generation dendrons and dendrimers were successfully synthesized in high yields utilizing 1.3-1.5 equiv of anhydride per hydroxyl group. Common characteristics of the esterification reaction were short reaction time, mild reaction conditions, easy monitoring by NMR analysis, and simple workup. This synthetic approach opens up the possibility to utilize orthogonal protecting groups of acetonide-protected 2,2-bis(hydroxymethyl) propionic anhydride as a novel building block.

  • 78.
    Martin-Serrano Ortiz, Angela
    et al.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Stenström, Patrik
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology.
    Antunez, Pablo Mesa
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Andrén, Oliver C. J.
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Torres, Maria J.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Montanez, Maria I.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Malkoch, Michael
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Design of multivalent fluorescent dendritic probes for site-specific labeling of biomolecules2018In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 56, no 15, p. 1609-1616Article in journal (Refereed)
    Abstract [en]

    Herein, the synthesis and characterization of orthogonal dendrons decorated with multiple units of fluorescent and a chemoselective group at a focal point, followed by specific antibody labeling, is presented. Fluorescence results confirm the applicability of the fluorescent probes for biomolecule labeling and fluorescent signal amplification.

  • 79.
    Mongkhontreerat, Surinthra
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Andrén, Oliver C. J.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Boujemaoui, Assya
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Dendritic hydrogels: From exploring various crosslinking chemistries to introducing functions and naturally abundant resources2015In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 53, no 21, p. 2431-2439Article in journal (Refereed)
    Abstract [en]

    Dendritic hydrogels from dendritic-linear-dendritic (DLD) block copolymers based on PEG and bis-MPA dendrons were constructed via UV-initiated thiol-ene, thiol-yne, CuAAC, and amine-NHS crosslinking chemistries. Stoichiometric ratio manipulations, prior to film formation, resulted in functional hydrogels with tuneable compressive moduli. The highest gel fractions for all networks were obtained at off-stoichiometric ratios with surplus of DLDs. Finally, sustainable networks were fabricated by amalgamating DLD, naturally abundant cellulose nanocrystal, and protein-based bovine serum albumin.

  • 80.
    Mongkhontreerat, Surinthra
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Walter, Marie V.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Andrén, Oliver C. J.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Cai, Yanling
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Beyond state of the art honeycomb membranes: High performance ordered arrays from multi-programmable linear-dendritic block copolymers2015In: Advanced Functional Materials, ISSN 1616-301X, E-ISSN 1616-3028, Vol. 25, no 30Article in journal (Refereed)
    Abstract [en]

    A new generation of honeycomb membranes is herein described from a novel library of multipurpose linear-dendritic block copolymers. These are accomplished by combining atom transfer radical polymerization together with dendrimer chemistry and click reactions. The resulted amorphous block copolymers, with T-g between 30 and 40 degrees C, display three important functions, i.e., pore generating aromatic groups, crosslinking azides, and multiple dendritic functional groups. All block copolymers enable the successful fabrication of honeycomb membranes through the facile breath figure method. The peripheral dendritic functionality is found to influence the porous morphologies from closed pored structure with pore size of 1.12 mu m(2) to open pore structure with pore size 10.26 mu m(2). Facile UV crosslinking of the azides yields membranes with highly durable structural integrity. Upon crosslinking, the pH and thermal stability are extended beyond the noncrosslinked membranes in which the porous integrity is maintained up to 400 degrees C and pH 1-14. Taking into account the straightforward and cost-efficient strategy to generate ordered, functional, and structurally stable honeycomb membranes on various solid substrates, it is apparent that these multipurpose block copolymers may unlock future applications including use as molds for soft lithography.

  • 81.
    Mongkhontreerat, Surinthra
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Walter, Marie V.
    Cai, Yanling
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Brismar, Hjalmar
    KTH, School of Engineering Sciences (SCI), Applied Physics, Cell Physics.
    Hulta, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Functional porous membranes from amorphous linear dendritic polyester hybrids2015In: Polymer Chemistry, ISSN 1759-9954, E-ISSN 1759-9962, Vol. 6, no 13, p. 2390-2395Article in journal (Refereed)
    Abstract [en]

    By combining ATRP, dendrimer chemistry and 'click' reactions, a library of novel linear dendritic block copolymers (hybrids) was successfully synthesized. The isolated polymers displayed hydrophilic alkyne groups and T-g's ranging from 14 degrees C to 67 degrees C. A T-g threshold of 39 degrees C was found necessary for straightforward porous membrane fabrication via the breath figure method. Exploiting the copper(I)-catalyzed azide-alkyne cycloaddition (CuAAC) reaction, a robust and benign protocol was identified enabling surface functionalization under aqueous conditions. Such manipulations included the introduction of fluorescent rhodamine for thorough assessment by confocal fluorescence microscopy as well as polyethylene glycol chains or perfluorinated groups for tuning the membrane wettability. Finally, with the initial indication of being nontoxic to human dermal fibroblasts (hDF) and osteoblast-like MG63, the porous membranes can potentially find use in the field of controlled cell culture such as patterning of cell growth.

  • 82.
    Mongkhontreerat, Surinthra
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Öberg, Kim
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Erixon, Lina
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Löwenhielm, Peter
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    UV initiated thiol-ene chemistry: a facile and modular synthetic methodology for the construction of functional 3D networks with tunable properties2013In: Journal of Materials Chemistry A, ISSN 2050-7488, Vol. 1, no 44, p. 13732-13737Article in journal (Refereed)
    Abstract [en]

    A facile methodology for the fabrication of functional crosslinked three dimensional (3D) networks has herein been explored via the benign and UV initiated thiol-ene coupling (TEC) chemistry. The careful selection of monomers or polymers and their feed ratio resulted in straightforward design of organic, inorganic and hydrogel networks with readily available alkenes or thiol functional groups. All crosslinked networks were fabricated within 1 second of UV exposure at wavelengths of 320-390 nm and generally exhibited excellent gel fractions around 90%. By introducing off-stoichiometric thiol and ene (OSTE) monomer feed ratios the window of mechanical properties could be manipulated. For the organic triazine system, the Young's modulus was altered from 780 MPa at an equimolar monomer ratio to soft 106 kPa for 2.5 equiv. with excess of thiol compared to enes. Postfunctionalizations with hydrophilic polyethylene glycols or acrylic acid and hydrophobic heneicosa-fluorododecyl acrylate were explored for the manipulation of functional networks. In this case, the rigid networks with excess of thiols were used as model substrates of which the initial contact angle (CA) of 60 degrees was decreased to 43 degrees by the introduction of acrylic acid and increased to 140 degrees by successful attachment of fluorinated molecules. Finally, amalgamating micropatterning strategy with simple postfunctionalizations of hydrophobic groups resulted in superhydrophobic rigid surfaces with a CA of 173 degrees.

  • 83.
    Montanez, Maria I.
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Campos, Luis M.
    Antoni, Per
    Hed, Yvonne
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Walter, Marie Valerié
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Krull, Brandon T.
    Khan, Anzar
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hawker, Craig J.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Accelerated Growth of Dendrimers via Thiol-Ene and Esterification Reactions2010In: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 43, no 14, p. 6004-6013Article in journal (Refereed)
    Abstract [en]

    By taking advantage of the orthogonal nature of thiol-ene coupling and anhydride based esterification reactions, a facile and chemoselective strategy to dendritic macromolecules has been developed The ability to interchange growth steps based on thiol-ene and anhydride chemistry allows the synthesis of fifth-generation dendrimers in only five steps and under benign reaction conditions In addition, the presented coupling chemistries eliminate the traditional need for protection/deprotection steps and afford dendrimers in high yield and purity The modularity of this strategy coupled with the latent reactivity of the alkene/hydroxyl chain ends was demonstrated by using different cores (alkene and hydroxyl functional), various AB(2) and CD2 monomers and a range of chain end groups As a result, three dendritic libraries were prepared which exhibited tunability of both the chemical functionality and physical properties including the fabrication of PEG hydrogels.

  • 84.
    Montanez, Maria I.
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hed, Yvonne
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Rapponnen, Jarmo
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Mayorga, Cristobalina
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Torres, Maria J.
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Blanca, Miguel
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Click chemistry: A highly robust methodology for the fabrication of bioactivate dendritic-cellulose surfaces2009In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 238Article in journal (Other academic)
  • 85.
    Montañez, Maria I.
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology. KTH, School of Engineering Sciences (SCI), Centres, VinnExcellence Center BiMaC Innovation.
    Hed, Yvonne
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Utsel, Simon
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Ropponen, Jarmo
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Wågberg, Lars
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Bifunctional Dendronized Cellulose Surfaces as Biosensors2011In: Biomacromolecules, ISSN 1525-7797, E-ISSN 1526-4602, Vol. 12, no 6, p. 2114-2125Article in journal (Refereed)
    Abstract [en]

    Well-defined dendronized cellulose substrates displaying multiple representations of dual-functionality were constructed by taking advantage of the efficiency of the click reaction combined with traditional anhydride chemistry. First, activated cellulose surfaces were decorated with several generations of dendrons, and their peripheral reactive groups were subsequently reacted with a trifunctional orthogonal monomer. The generated substrate tool box was successfully explored by accurately tuning the surface function using a versatile orthogonal dual postfunctionalization approach. In general, the reactions were monitored by using a click-dye reagent or a quartz crystal microbalance (QCM) technique, and the resulting surfaces were well-characterized using XPS, and contact angle measurements. Utilizing this approach two different surfaces have been obtained; that is, triethylenglycol oligomers and amoxicillin molecules were efficiently introduced to the dendritic surface. As a second example, mannose-decorated hydroxyl functional surfaces illustrated their potential as biosensors by multivalent detection of lectin protein at concentration as low as 5 nM.

  • 86.
    Neus, Feliu Torres
    et al.
    Karolinska Inst, Stockholm, Sweden .
    Walter, Marie V.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Montanez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Kunzmann, Andrea
    Karolinska Inst, Stockholm, Sweden .
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Nyström, Andreas
    Karolinska Inst, Stockholm, Sweden .
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Fadeel, Bengt
    Karolinska Inst, Stockholm, Sweden .
    Biocompatibility of polyester dendrimers in comparison to polyamidoamine dendrimers2012In: Toxicology Letters, ISSN 0378-4274, E-ISSN 1879-3169, Vol. 211, p. S203-S204Article in journal (Other academic)
  • 87.
    Nilsson, Camilla
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Simpson, Neil
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Johansson, Mats K. G.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malmström, Eva E.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Synthesis and Thiol-Ene Photopolymerization of Allyl Ether Functionalized Dendrimers2008In: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 46, no 4, p. 1339-1348Article in journal (Refereed)
    Abstract [en]

    Well-defined, allyl-ether functional, first-generation dendrimers have been synthesized. The convergent growth approach was utilized, using the anhydride of the allyl-ether terminated building block. Three different core moieties were used: trimethylolpropane, trisphenol, and ditrimethylolpropane. The coupling reactions proceeded in good yields and all compounds were characterized by NMR, MALDI-TOF, and SEC. The allyl-terminated dendrimers were crosslinked by thiol-ene chemistry, using a multifunctional thiol, TriThiol, to give clear and smooth films. The photopolymerization was conducted in the presence of a photoinitiator, Irgacure 651, and no traces of either allyl-ether groups or thiols were observed by FT-Raman after cure. All crosslinked films were characterized with respect to mechanical (DMA) and thermal (DSC) properties. It was found that homogeneous networks were formed and that the core functionality and structure had little effect on the network properties.

  • 88.
    Nilsson, Camilla
    et al.
    KTH, School of Chemical Science and Engineering (CHE).
    Simpson, Neil
    KTH, School of Chemical Science and Engineering (CHE).
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE).
    Johansson, Mats
    KTH, School of Chemical Science and Engineering (CHE).
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE).
    POLY 664-Polymer networks based on dendrimer monomers2007In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Article in journal (Other academic)
  • 89. Nirwan, Viraj Pratap
    et al.
    Fahmi, Amir
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE).
    Electrospinning of Hybrid Nanofibres Elaborated with PEG Core Dendrimers and SPIONs Synthesized in-situ: as Multifunctional Material for Biomedical Applications2017In: Proceedings of the 2017 IEEE 7th International Conference on Nanomaterials: Applications and Properties, NAP 2017 / [ed] Pogrebnjak, AD Novosad, V Zukowski, P Protsenko, SI Shabelnyk, Y, Institute of Electrical and Electronics Engineers (IEEE), 2017, article id UNSP 03NNSA37Conference paper (Refereed)
    Abstract [en]

    Nanoparticles have emerged as a major attraction for preparation of novel materials with unique properties. They are usually a combination of extraordinary materials not found in nature. Expanding on that concept, nanofibres with additional components for biomedical applications were fabricated. Magnetic nanoparticles were chosen because they exhibit super paramagnetic properties for a wide range of applications in biomedicine. These particles were coated with polymer PEG 2000, which allowed bond formation of bond between the positive end of the dipole in SPIONs and the anion in PEG 2000, thus providing stability for use for a few weeks after preparation and further helping the interaction with PEG dendrimers and PEO. A colloid of SPIONs with PEG dendrimers and PEO was then used for electrospinning, providing multifunctional nanofibres of SPIONs characteristic rust-colour. The average diameter depended on the generation of dendrimers used in the colloid, ranging from 113 nm to 123 nm. The fibres were further characterized for thermal stability using TGA. The nanofibres proved a higher thermal stability, which is one of the many functionalities obtained by consisting of diverse, nanoparticle components. This can lead to numerous possibilities that could be fabricated by building on this methodology. For example, hybrid materials containing pioneering combinations can be developed.

  • 90.
    Nordberg, Axel
    et al.
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    von Holst, Hans
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Fibre reinforced Thiol-Ene patch fixation of bone fracturesManuscript (preprint) (Other academic)
  • 91.
    Nordberg, Axel
    et al.
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Montanez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    von Holst, Hans
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Highly Adhesive Phenolic Compounds as Interfacial Primers for Bone Fracture Fixations2010In: ACS APPLIED MATERIALS & INTERFACES, ISSN 1944-8244, Vol. 2, no 3, p. 654-657Article in journal (Refereed)
    Abstract [en]

    Bone fractures are today scabilized with screws and metal plates. More complicated Fractures require alternative treatments that exclude harsh surgical conditions. By adapting the benign and UV initiated thiol-ene reaction, we efficiently fabricated triazine-based, fiber-reinforced adhesive patches within 2 s. To enhance their bone adhesion properties, we found that a pre-treatment step of bone surfaces with phenolic dopamine and poly(parahydroxystyrene) compounds was successful. The latter display the greatest E-module of 3.4 MPa in shear strength. All patches exhibited low cytotoxicity and can therefore find potential use in future treatments of bone fractures.

  • 92.
    Nordberg, Axel
    et al.
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Montañez, Maria I.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Ramakrishnan, Subashiyni
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    von Holst, Hans
    KTH, School of Technology and Health (STH), Neuronic Engineering.
    Higly adhesive DOPA primers for fibre reinforced Thiol-Ene patch fixation of bone fractures.Manuscript (preprint) (Other academic)
  • 93.
    Nordstrom, Randi
    et al.
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Singh, Shalini
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Malkoch, Michael
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden.;Univ Copenhagen, Bispebjerg Hosp, Wound Healing Ctr, Dept Biomed Sci, DK-2200 Copenhagen, Denmark..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.;Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark..
    Degradable dendritic nanogels as carriers for antimicrobial peptides2019In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 554, p. 592-602Article in journal (Refereed)
    Abstract [en]

    In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPS). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40-60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 mu M.

  • 94. Nordström, R.
    et al.
    Nyström, L.
    Andrén, Oliver C. J.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Umerska, A.
    Davoudi, M.
    Schmidtchen, A.
    Malmsten, M.
    Membrane interactions of microgels as carriers of antimicrobial peptides2018In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 513, p. 141-150Article in journal (Refereed)
    Abstract [en]

    Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use. 

  • 95.
    Nordström, Randi
    et al.
    Ms, Dept Pharm, Uppsala, Sweden..
    Nyström, Lina
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Engineering Sciences in Chemistry, Biotechnology and Health (CBH), Fibre- and Polymer Technology, Coating Technology.
    Umerska, Anita
    MINT Univ Angers, Angers, France..
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Poly(acrylic acid) microgels as carriers for antimicrobial peptides2018In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Article in journal (Other academic)
  • 96.
    Nystrom, Daniel
    et al.
    KTH, School of Chemical Science and Engineering (CHE).
    Lindqvist, Josefina
    KTH, School of Chemical Science and Engineering (CHE).
    Östmark, Emma
    KTH, School of Chemical Science and Engineering (CHE).
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE).
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE).
    Johansson, Mats
    KTH, School of Chemical Science and Engineering (CHE).
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE).
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE).
    POLY 598-Superhydrophobic biofiber surfaces obtained via ATRP and postfunctionalization reactions2007In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Article in journal (Other academic)
  • 97.
    Nyström, Andreas
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Furo, Istvan
    KTH, School of Chemical Science and Engineering (CHE), Chemistry.
    Nyström, Daniel
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Unal, Kerem
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Vamvounis, George
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hawker, Craig
    Wooley, Karen
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Characterization of Poly(norbornene) Dendronized Polymers Prepared by Ring-Opening Metathesis Polymerization of Dendron Bearing Monomers2006In: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 39, no 21, p. 7241-7249Article in journal (Refereed)
    Abstract [en]

    The preparation and characterization of a series of first to fourth generation dendronized poly-(norbornene)s are presented. The monomers were synthesized in a divergent fashion from 5-norbornene-2-methanol, utilizing the acetonide protected anhydride of 2,2-bis(methylol)propionic acid. The norbornenyl bearing dendrons were polymerized by ring-opening metathesis polymerization, and it was found that the Grubbs' first generation catalyst resulted in polymers with lower polydispersity compared to the materials obtained when employing the second generation catalyst. Two series of first to fourth generation polymers were characterized by DSC, SEC, and dynamic rheological measurements. In addition, it was found that the fourth generation material could form regular, porous membranes and birefringent fibers. The membranes were characterized with atomic force and optical microscopy. The birefringent fibers were analyzed with X-ray diffraction, polarized FTIR, and polarized optical microscopy.

  • 98.
    Nyström, Andreas
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Dendronized ABA Triblock copolymers by Reversible Addition-Fragmentation Transfer Polymerization2006Manuscript (preprint) (Other academic)
  • 99.
    Nyström, Daniel
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Lindqvist, J.
    Östmark, Emma
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Antoni, Per
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Johansson, Mats
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Malmström, Eva
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Hult, Anders
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology.
    Superhydrohobic bio-fibre surfaces obtained via ATRP and postfunctioalizations reactions2007Manuscript (preprint) (Other academic)
  • 100.
    Olofsson, Kristina
    et al.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Andrén, Oliver C. J.
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Malkoch, Michael
    KTH, School of Chemical Science and Engineering (CHE), Fibre and Polymer Technology, Coating Technology.
    Recent Advances on Crosslinked Dendritic Networks2014In: Journal of Applied Polymer Science, ISSN 0021-8995, E-ISSN 1097-4628, Vol. 131, no 3, p. 39876-Article, review/survey (Refereed)
    Abstract [en]

    The branched architectures of dendritic polymers display a large number of end groups, and dendrimers have been extensively evaluated as scaffolds in a large array of research fields, including biomedicine and nanotechnology. From the number of potential applications that require advanced crosslinked films, dendritic macromolecules are attractive as scaffolds that deliver on promising crosslinked three-dimensional (3D) networks. This review briefly covers a description of the family of functional dendritic polymers, ranging from dendrimers and dendrons to hyperbranched polymers and dendritic linear hybrids. The review also contains a detailed report on proposed chemistries for the exploitation of dendritic materials as scaffolds in the field of advanced networks.

123 51 - 100 of 136
CiteExportLink to result list
Permanent link
Cite
Citation style
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf