Endre søk
Begrens søket
123 51 - 100 of 128
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
Treff pr side
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
Sortering
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
Merk
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 51. Long, David A.
    et al.
    Unal, Kerem
    Pratt, Russell C.
    Malkoch, Michael
    Frommer, Jane
    Localized "Click" chemistry through dip-pen nanolithography2007Inngår i: Advanced Materials, ISSN 0935-9648, E-ISSN 1521-4095, Vol. 19, nr 24, s. 4471-+Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Local reactions are triggered by delivering molecules from an AFM probe tip, allowing for direct modification of chemically functionalized surfaces. Silicon wafer-bound acetylene moieties readily undergo 1,3-dipolar cycloadddition with solution-phase azides delivered from an AFM tip. This selective and robust technique allows for the facile creation and placement of sub-micrometer-sized features.

  • 52.
    Long, Hui
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Cellulose reinforced hydrogel via click chemistry2012Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 243Artikkel i tidsskrift (Annet vitenskapelig)
  • 53.
    Lundberg, Pontus
    et al.
    KTH, Skolan för kemivetenskap (CHE).
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE).
    Fogelström, Linda
    KTH, Skolan för kemivetenskap (CHE).
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE).
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE).
    POLY 660-Controlled design of amphiphilic block-copolymers using ring-opening polymerization and click chemistry2007Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Artikkel i tidsskrift (Annet vitenskapelig)
  • 54.
    Lundberg, Pontus
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Bruin, Anouk
    Klijnstra, Job W.
    Nyström, Andreas M.
    Johansson, Mats K. G.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Poly(ethylene glycol)-Based Thiol-ene Hydrogel Coatings-Curing Chemistry, Aqueous Stability, and Potential Marine Antifouling Applications2010Inngår i: ACS Applied Materials and Interfaces, ISSN 1944-8244, E-ISSN 1944-8252, Vol. 2, nr 3, s. 903-912Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Photocured thiol-ene hydrogel coatings based on poly(ethylene glycol) (PEG) were investigated for marine antifouling purposes. By varying the PEG length, vinylic end-group, and thiol cross-linker, a library of hydrogel coatings with different structural composition was efficiently accomplished, with or without ester linkages. The thiol-methacrylate and thiol-allyl systems were evaluated with respect to curing, degradation, as well as antifouling properties. Moth acrylate-based systems exhibited homopolymerization, whereas allyl-based systems reacted more selectively through thiol-ene couplings reaction. The ester-free hydrogels elucidated higher hydrolytic stability whereas longer PEG chains accelerated the degradation process. The antifouling properties were evaluated by protein adsorption With Bovine serum albumin (BSA) and bioassays with the marine bacteria, Cobetia marina, and the marine diatom, Amphora coffeaeformis; in all tests, longer PEG lengths improved the antifouling properties.

  • 55.
    Lundberg, Pontus
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Daehne, Bernd
    Andrén, Oliver
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Laurin, Richard
    Watermann, Burkhard
    Lundin, Claes
    Johansson, Mats K. G.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Poly(ethylene glycol)-based thiol-ene hydrogels evaluated for their potential as antifouling coatings: Field studies and mechanical propertiesArtikkel i tidsskrift (Annet vitenskapelig)
  • 56. Lundberg, Pontus
    et al.
    Hawker, Craig J.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Click assisted one-pot multi-step reactions in polymer science: Accelerated synthetic Protocols2008Inngår i: Macromolecular rapid communications, ISSN 1022-1336, E-ISSN 1521-3927, Vol. 29, nr 12-13, s. 998-1015Artikkel, forskningsoversikt (Fagfellevurdert)
    Abstract [en]

    Presently, the majority of reports deal with combining chemical reactions, in a stepwise fashion, to obtain well-defined polymers. In the future, chemists need to address new challenges such as increase in the range of available efficient reactions, developing libraries of compatible one-pot reactions, and the application of obtained materials in key industries. Indeed, the rising importance of the click concept has now devised robust synthetic approaches in various fields of research. The unique selectivity of the click reaction is today a new found toolbox for scientists to investigate one-pot multi-step systems. Several accelerated protocols have elegantly been reported to obtain a library of advanced polymers.

  • 57.
    Lundberg, Pontus
    et al.
    Univ Calif Santa Barbara, Mat Res Lab, Santa Barbara, USA.
    Lynd, Nathaniel A.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Nyström, Andreas M.
    Hawker, Craig J.
    Novel reversible hydrogels with pH-responsiveness at physiological pH2012Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 243Artikkel i tidsskrift (Annet vitenskapelig)
  • 58. Lundberg, Pontus
    et al.
    Lynd, Nathaniel A.
    Zhang, Yuning
    Zeng, Xianghui
    Krogstad, Daniel V.
    Paffen, Tim
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Nyström, Andreas M.
    Hawker, Craig J.
    pH-triggered self-assembly of biocompatible histamine-functionalized triblock copolymers2013Inngår i: Soft Matter, ISSN 1744-683X, E-ISSN 1744-6848, Vol. 9, nr 1, s. 82-89Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Histamine functionalized poly(allyl glycidyl ether)-b-poly(ethylene glycol)-b-poly(allyl glycidyl ether) (PAGE-PEO-PAGE) triblock copolymers represent a new class of physically cross-linked, pH-responsive hydrogels with significant potential for biomedical applications. These telechelic triblock copolymers exhibited abrupt and reversible hydrogelation above pH 7.0 due to a hydrophilic/hydrophobic transition of the histamine units to form a network of hydrophobic domains bridged by a hydrophilic PEO matrix. These hydrophobic domains displayed improved ordering upon increasing pH and self-assembled into a body centered cubic lattice at pH 8.0, while at lower concentrations formed well-defined micelles. Significantly, all materials were found to be non-toxic when evaluated on three different cell lines and suggests a range of medical and biomedical applications.

  • 59.
    Lundberg, Pontus
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Walter, Valérie Marie
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Montañez, Maria I.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Daniel
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Linear dendritic polymeric amphiphiles with intrinsic biocompatibility: synthesis and characterization to fabrication of micelles and honeycomb membranes2011Inngår i: Polymer Chemistry, ISSN 1759-9954, Vol. 2, s. 394-402Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Linear dendritic hybrid materials enable a range of architectural variations which offers novel possibilities in the tailoring of polymeric materials. In this study dendrons based on the 2,2-bis(methylol)propionic acid (bis-MPA) building block, bearing click chemistry moieties in the core and peripheral hydroxyl functionalities, have been used as macroinitiators for ring opening polymerization of ε-caprolactone. A library of star branched polymers with poly(ε-caprolactone) chains was initially constructed using dendrons up to 4th generation. In a second step, the popular CuAAC or thiol–ene click reaction was efficiently used to attach poly(ethylene glycol) chains of different lengths to the core. Potential applications of the resulted amphiphilic linear dendritic hybrids were investigated. Both self-assembled micelles loaded with doxorubicin anticancer drug and ordered honeycomb membranes with enhanced surface area were successfully fabricated and characterized.

  • 60. Lundgren, Anders
    et al.
    Hed, Yvonne
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Öberg, Kim
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Sellborn, Anders
    Fink, Helen
    Loewenhielm, Peter
    Kelly, Jonathan
    Malkoch, Michael
    Berglin, Mattias
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Self-Assembled Arrays of Dendrimer-Gold-Nanoparticle Hybrids for Functional Cell Studies2011Inngår i: Angewandte Chemie International Edition, ISSN 1433-7851, E-ISSN 1521-3773, Vol. 50, nr 15, s. 3450-3453Artikkel i tidsskrift (Fagfellevurdert)
  • 61. Mahltig, Boris
    et al.
    Cheval, Nicolas
    Astachov, Vladimir
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Montanez, Maria I.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Haase, Hajo
    Fahmi, Amir
    Hydroxyl functional polyester dendrimers as stabilizing agent for preparation of colloidal silver particles-a study in respect to antimicrobial properties and toxicity against human cells2012Inngår i: Colloid and Polymer Science, ISSN 0303-402X, E-ISSN 1435-1536, Vol. 290, nr 14, s. 1413-1421Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The presented study concerns the preparation and investigation of silver particles in presence of hydroxylated polyester dendrimers used as stabilizing agent. Altogether a full series of water soluble and aliphatic bis-MPA dendrimers from first to fifth generation was used as to stabilize silver nanoparticles in situ. A special focus is set on the biological properties. The antibacterial properties of the dendrimer stabilized silver particles are tested against Escherichia coli and the toxicity against human cells is tested with the human epithelial cell line A549. Under the chosen testing arrangement, it was observed that the silver particles contain a significant antibacterial effect against E. coli. Silver particles stabilized in situ with dendrimers of higher generation seem to contain a stronger antibacterial property. No toxicity against human cells was observed for the silver particles even in case of the highest investigated silver concentration. Altogether the here prepared and investigated silver particles could offer a great potential for application as antibacterial agent with low human toxicity.

  • 62.
    Malkoch, Michael
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    New approaches in synthesis and characterization of dendritic macromolecules based on bis-mpa2003Doktoravhandling, med artikler (Annet vitenskapelig)
  • 63.
    Malkoch, Michael
    et al.
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Carlmark, Anna
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Wodegiorgis, A
    Hult, Anders
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Dendronized aliphatic polymers by a combination of ATRP and divergent growth2004Inngår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 37, nr 2, s. 322-329Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Dendronized, hybrid dendritic-linear polymers were synthesized by either the "graft-onto" route or by atom transfer radical polymerization (ATRP) of macromonomers. In both ways, the main chain was composed of acrylate repeating units and the dendrons were based on the aliphatic ester skeleton obtained from 2,2-bis(methylol)propionic acid (bis-MPA). ATRP of macromonomers was not a viable route for monomers with side chains larger than second-generation dendrons, which is why a combination of the two approaches was required to obtain polymers with larger side chains. The "graft-onto" route was conducted by reacting hydroxyl groups on the main chain with the acetonide-protected 2,2-bis(hydroxymethyl)propionic anhydride. The acetonide protecting group was easily removed by treating a solution of the polymer with an acidic ion-exchange resin. Dendronized polymers with 1-3 generation dendron side groups were synthesized with a maximum molecular weight of ca. 86 kDa. The products were analyzed by H-1 and C-13 NMR, SEC, and MALDI-TOF.

  • 64.
    Malkoch, Michael
    et al.
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Claesson, Hans
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Löwenhielm, Peter
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Hult, Anders
    KTH, Tidigare Institutioner, Fiber- och polymerteknologi.
    Synthesis and characterization of 2,2-bis(methylol)propionic acid dendrimers with different cores and terminal groups2004Inngår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 42, nr 7, s. 1758-1767Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Three sets of aliphatic polyester dendrimers based on 2,2-bis(methylol)propionic acid (bis-MPA) were synthesized. Two of the sets had benzylidene terminal groups and either a trimethylolpropane or triphenolic core moiety. The last set had acetonide terminal groups and a triphenolic core moiety. Benzylidene-[G#1]-anhydride and acetonide-[G#1] -anhydride were used as the reactive building blocks in the construction of all dendrimers. The large excess of building blocks used in the coupling reactions initially resulted in considerable material loss. This waste was eliminated through the development of a recycling method. H-1 and C-13 NMR and matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) analysis were used to verify the purity of all compounds. Size exclusion chromatography (SEC) was used, as well as MALDI-TOF, for molecular weight determinations. The SEC measurements were conducted with a universal calibration method and an online right-angle laser light scattering detector. Measured dendrimer molecular weights were close to their theoretical molar masses. Observations were also made of the hydrodynamic radius and intrinsic viscosity for the different dendrimers.

  • 65.
    Malkoch, Michael
    et al.
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Hallman, Kristina
    KTH, Tidigare Institutioner                               , Kemi.
    Lutsenko, Serghey
    KTH, Tidigare Institutioner                               , Kemi.
    Hult, Anders
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Moberg, Christina
    KTH, Tidigare Institutioner                               , Kemi.
    Dendritic oxazoline ligands in enantioselective palladium-catalyzed allylic alkylations2002Inngår i: Journal of Organic Chemistry, ISSN 0022-3263, E-ISSN 1520-6904, Vol. 67, nr 23, s. 8197-8202Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    First to fourth generation dendritic substituents based on 2,2-bis(hydroxymethyl)propionic acid and (1R,2S,5R)-menthoxyacetic acid were attached to 2-(hydroxymethyl)pyridinooxazoline and his[4-(hydroxymethyl)oxazoline] compounds. The new ligands obtained were assessed in palladium-catalyzed allylic alkylations. The first type of ligands exhibited enantioselectivity similar to that of a benzoyl ester derivative, whereas the latter type of ligands afforded products with higher selectivity than the analogous benzoyl ester. The activity of the dendritic catalysts decreased with increasing generation.

  • 66.
    Malkoch, Michael
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malmström Jonsson, Eva
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Nyström, A. M.
    Dendrimers: Properties and Applications2012Inngår i: Polymer Science: A Comprehensive Reference, 10 Volume Set, Elsevier, 2012, Vol. 6, s. 113-176Kapittel i bok, del av antologi (Fagfellevurdert)
    Abstract [en]

    This chapter provides a review of the use of various dendrimer families in drug-delivery applications. The first part gives a brief introduction to the field of dendrimer science, also covering the synthesis of the most commonly used dendrimers. The second part provides a description of the chemical, structural, and physical characterization of dendrimers along with a brief description of various techniques employed, with nuclear magnetic resonance, matrix-assisted laser desorption/ionization time-of-flight, and microscopy on dendrimers described in more detail. Special emphasis is given to highlight the interplay between chemical features (repeating unit, end groups, and size) and properties. The last part provides a more detailed and in-depth overview of various dendrimer-drug conjugates and their characteristics in drug-delivery aspects.

  • 67. Malkoch, Michael
    et al.
    Schleicher, K.
    Drockenmuller, E.
    Hawker, C. J.
    Russell, T. P.
    Wu, P.
    Fokin, V. V.
    Structurally diverse dendritic libraries: A highly efficient functionalization approach using Click chemistry2005Inngår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 38, nr 9, s. 3663-3678Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The high fidelity and efficiency of Click chemistry are exploited in the synthesis of a library of chain end functionalized dendritic macromolecules. In this example, the selectivity of the Cu-catalyzed [3 + 2 pi] cycloaddition reaction of azides with terminal acetylenes, coupled with mild reaction conditions, permits unprecedented functional group tolerance during the derivatization of dendrimeric and hyperbranched scaffolds. The resulting dendritic libraries are structurally diverse, encompassing a variety of backbones/surface functional groups, and are prepared in almost quantitative yields under very mild conditions. The robust and simple nature of this procedure, combined with its applicability to many aspects of polymer synthesis and materials chemistry, demonstrates an evolving synergy between advanced organic chemistry and functional materials.

  • 68. Malkoch, Michael
    et al.
    Thibault, R. J.
    Drockenmuller, E.
    Messerschmidt, M.
    Voit, B.
    Russell, T. P.
    Hawker, C. J.
    Orthogonal approaches to the simultaneous and cascade functionalization of macromolecules using click chemistry2005Inngår i: Journal of the American Chemical Society, ISSN 0002-7863, E-ISSN 1520-5126, Vol. 127, nr 42, s. 14942-14949Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The development of selective chemistries that are orthogonal to the diverse array of functional groups present in many polymeric systems is becoming an important tool for the synthesis and use of macromolecules in fields ranging from biomedical devices to nanotechnology. By combining copper-catalyzed cycloaddition chemistry with other synthetic transformations such as esterification, amidation, etc., highly efficient and modular simultaneous and cascade functionalization strategies have been developed. These single-step strategies for preparing multifunctional macromolecules represent a significant advance as compared to traditional multistep approaches, and the utility of these concepts is demonstrated by selective preparation of a diverse range of orthogonally functionalized vinyl polymers.

  • 69. Malkoch, Michael
    et al.
    Vestberg, Robert
    Gupta, Nalini
    Mespouille, Laetitia
    Dubois, Philipe
    Mason, Andrew F.
    Hedrick, James L.
    Liao, Qi
    Frank, Curtis W.
    Kingsbury, Kevin
    Hawker, Craig J.
    Synthesis of well-defined hydrogel networks using Click chemistry2006Inngår i: Chemical Communications, ISSN 1359-7345, E-ISSN 1364-548X, nr 26, s. 2774-2776Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    New PEG-based hydrogel materials have been synthesized by Click chemistry and shown to result in well-defined networks having significantly improved mechanical properties; the selectivity of the azide/ acetylene coupling reaction also allows for the incorporation of various additives and functional groups leading to chemical tailoring of the hydrogels.

  • 70.
    Malkoch, Michel
    et al.
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Hult, Anders
    KTH, Tidigare Institutioner                               , Fiber- och polymerteknologi.
    Rapid and efficient synthesis of aliphatic ester dendrons and dendrimers2002Inngår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 35, nr 22, s. 8307-8314Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A divergent approach to synthesize dendritic aliphatic polyester structures based on 2,2-bis(hydroxymethyl) propionic acid (bis-MPA) is described. The key building block is the anhydride of isopropylidene-2,2-bis(methoxy) propionic acid which is synthesized in high yields through self-dehydration, utilizing N,N'-dicyclohexylcarbodiimide (DCC) as reagent. The high reactivity of the anhydride toward hydroxyl groups makes the divergent synthesis of dendrimers and dendrons viable. Dendritic growth occurs in the presence of protecting groups sensitive toward hydrogenolysis, such as benzyl esters and ethers. The acetonide-protecting group is easily removed under acidic conditions using DOWEX 50W-X2 resin in methanol. Fourth-generation dendrons and dendrimers were successfully synthesized in high yields utilizing 1.3-1.5 equiv of anhydride per hydroxyl group. Common characteristics of the esterification reaction were short reaction time, mild reaction conditions, easy monitoring by NMR analysis, and simple workup. This synthetic approach opens up the possibility to utilize orthogonal protecting groups of acetonide-protected 2,2-bis(hydroxymethyl) propionic anhydride as a novel building block.

  • 71.
    Martin-Serrano Ortiz, Angela
    et al.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Stenström, Patrik
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi.
    Antunez, Pablo Mesa
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Torres, Maria J.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Montanez, Maria I.
    IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Res Lab, Plaza Hosp Civil, Malaga 29009, Spain.;IBIMA Reg Univ Hosp Malaga UMA, Hosp Civil, Allergy Unit, Plaza Hosp Civil, Malaga 29009, Spain.;BIONAND Andalusian Ctr Nanomed & Biotechnol, Parque Tecnol Andalucia, Malaga 29590, Spain..
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Design of multivalent fluorescent dendritic probes for site-specific labeling of biomolecules2018Inngår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 56, nr 15, s. 1609-1616Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Herein, the synthesis and characterization of orthogonal dendrons decorated with multiple units of fluorescent and a chemoselective group at a focal point, followed by specific antibody labeling, is presented. Fluorescence results confirm the applicability of the fluorescent probes for biomolecule labeling and fluorescent signal amplification.

  • 72.
    Mongkhontreerat, Surinthra
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Andrén, Oliver C. J.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Boujemaoui, Assya
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Dendritic hydrogels: From exploring various crosslinking chemistries to introducing functions and naturally abundant resources2015Inngår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 53, nr 21, s. 2431-2439Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Dendritic hydrogels from dendritic-linear-dendritic (DLD) block copolymers based on PEG and bis-MPA dendrons were constructed via UV-initiated thiol-ene, thiol-yne, CuAAC, and amine-NHS crosslinking chemistries. Stoichiometric ratio manipulations, prior to film formation, resulted in functional hydrogels with tuneable compressive moduli. The highest gel fractions for all networks were obtained at off-stoichiometric ratios with surplus of DLDs. Finally, sustainable networks were fabricated by amalgamating DLD, naturally abundant cellulose nanocrystal, and protein-based bovine serum albumin.

  • 73.
    Mongkhontreerat, Surinthra
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Walter, Marie V.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Andrén, Oliver C. J.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Cai, Yanling
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Beyond state of the art honeycomb membranes: High performance ordered arrays from multi-programmable linear-dendritic block copolymers2015Inngår i: Advanced Functional Materials, ISSN 1616-301X, E-ISSN 1616-3028, Vol. 25, nr 30Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A new generation of honeycomb membranes is herein described from a novel library of multipurpose linear-dendritic block copolymers. These are accomplished by combining atom transfer radical polymerization together with dendrimer chemistry and click reactions. The resulted amorphous block copolymers, with T-g between 30 and 40 degrees C, display three important functions, i.e., pore generating aromatic groups, crosslinking azides, and multiple dendritic functional groups. All block copolymers enable the successful fabrication of honeycomb membranes through the facile breath figure method. The peripheral dendritic functionality is found to influence the porous morphologies from closed pored structure with pore size of 1.12 mu m(2) to open pore structure with pore size 10.26 mu m(2). Facile UV crosslinking of the azides yields membranes with highly durable structural integrity. Upon crosslinking, the pH and thermal stability are extended beyond the noncrosslinked membranes in which the porous integrity is maintained up to 400 degrees C and pH 1-14. Taking into account the straightforward and cost-efficient strategy to generate ordered, functional, and structurally stable honeycomb membranes on various solid substrates, it is apparent that these multipurpose block copolymers may unlock future applications including use as molds for soft lithography.

  • 74.
    Mongkhontreerat, Surinthra
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Walter, Marie V.
    Cai, Yanling
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Brismar, Hjalmar
    KTH, Skolan för teknikvetenskap (SCI), Tillämpad fysik, Cellens fysik.
    Hulta, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Functional porous membranes from amorphous linear dendritic polyester hybrids2015Inngår i: Polymer Chemistry, ISSN 1759-9954, E-ISSN 1759-9962, Vol. 6, nr 13, s. 2390-2395Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    By combining ATRP, dendrimer chemistry and 'click' reactions, a library of novel linear dendritic block copolymers (hybrids) was successfully synthesized. The isolated polymers displayed hydrophilic alkyne groups and T-g's ranging from 14 degrees C to 67 degrees C. A T-g threshold of 39 degrees C was found necessary for straightforward porous membrane fabrication via the breath figure method. Exploiting the copper(I)-catalyzed azide-alkyne cycloaddition (CuAAC) reaction, a robust and benign protocol was identified enabling surface functionalization under aqueous conditions. Such manipulations included the introduction of fluorescent rhodamine for thorough assessment by confocal fluorescence microscopy as well as polyethylene glycol chains or perfluorinated groups for tuning the membrane wettability. Finally, with the initial indication of being nontoxic to human dermal fibroblasts (hDF) and osteoblast-like MG63, the porous membranes can potentially find use in the field of controlled cell culture such as patterning of cell growth.

  • 75.
    Mongkhontreerat, Surinthra
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Öberg, Kim
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Erixon, Lina
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Löwenhielm, Peter
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    UV initiated thiol-ene chemistry: a facile and modular synthetic methodology for the construction of functional 3D networks with tunable properties2013Inngår i: Journal of Materials Chemistry A, ISSN 2050-7488, Vol. 1, nr 44, s. 13732-13737Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A facile methodology for the fabrication of functional crosslinked three dimensional (3D) networks has herein been explored via the benign and UV initiated thiol-ene coupling (TEC) chemistry. The careful selection of monomers or polymers and their feed ratio resulted in straightforward design of organic, inorganic and hydrogel networks with readily available alkenes or thiol functional groups. All crosslinked networks were fabricated within 1 second of UV exposure at wavelengths of 320-390 nm and generally exhibited excellent gel fractions around 90%. By introducing off-stoichiometric thiol and ene (OSTE) monomer feed ratios the window of mechanical properties could be manipulated. For the organic triazine system, the Young's modulus was altered from 780 MPa at an equimolar monomer ratio to soft 106 kPa for 2.5 equiv. with excess of thiol compared to enes. Postfunctionalizations with hydrophilic polyethylene glycols or acrylic acid and hydrophobic heneicosa-fluorododecyl acrylate were explored for the manipulation of functional networks. In this case, the rigid networks with excess of thiols were used as model substrates of which the initial contact angle (CA) of 60 degrees was decreased to 43 degrees by the introduction of acrylic acid and increased to 140 degrees by successful attachment of fluorinated molecules. Finally, amalgamating micropatterning strategy with simple postfunctionalizations of hydrophobic groups resulted in superhydrophobic rigid surfaces with a CA of 173 degrees.

  • 76.
    Montanez, Maria I.
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Campos, Luis M.
    Antoni, Per
    Hed, Yvonne
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Walter, Marie Valerié
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Krull, Brandon T.
    Khan, Anzar
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hawker, Craig J.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Accelerated Growth of Dendrimers via Thiol-Ene and Esterification Reactions2010Inngår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 43, nr 14, s. 6004-6013Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    By taking advantage of the orthogonal nature of thiol-ene coupling and anhydride based esterification reactions, a facile and chemoselective strategy to dendritic macromolecules has been developed The ability to interchange growth steps based on thiol-ene and anhydride chemistry allows the synthesis of fifth-generation dendrimers in only five steps and under benign reaction conditions In addition, the presented coupling chemistries eliminate the traditional need for protection/deprotection steps and afford dendrimers in high yield and purity The modularity of this strategy coupled with the latent reactivity of the alkene/hydroxyl chain ends was demonstrated by using different cores (alkene and hydroxyl functional), various AB(2) and CD2 monomers and a range of chain end groups As a result, three dendritic libraries were prepared which exhibited tunability of both the chemical functionality and physical properties including the fabrication of PEG hydrogels.

  • 77.
    Montanez, Maria I.
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Hed, Yvonne
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Rapponnen, Jarmo
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Mayorga, Cristobalina
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Torres, Maria J.
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Blanca, Miguel
    Carlos Haya Hosp, Res Unit Allerg Res, Malaga 29010, Spain..
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Click chemistry: A highly robust methodology for the fabrication of bioactivate dendritic-cellulose surfaces2009Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 238Artikkel i tidsskrift (Annet vitenskapelig)
  • 78.
    Montañez, Maria I.
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik. KTH, Skolan för teknikvetenskap (SCI), Centra, VinnExcellens Centrum BiMaC Innovation.
    Hed, Yvonne
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Utsel, Simon
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Ropponen, Jarmo
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Wågberg, Lars
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Bifunctional Dendronized Cellulose Surfaces as Biosensors2011Inngår i: Biomacromolecules, ISSN 1525-7797, E-ISSN 1526-4602, Vol. 12, nr 6, s. 2114-2125Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Well-defined dendronized cellulose substrates displaying multiple representations of dual-functionality were constructed by taking advantage of the efficiency of the click reaction combined with traditional anhydride chemistry. First, activated cellulose surfaces were decorated with several generations of dendrons, and their peripheral reactive groups were subsequently reacted with a trifunctional orthogonal monomer. The generated substrate tool box was successfully explored by accurately tuning the surface function using a versatile orthogonal dual postfunctionalization approach. In general, the reactions were monitored by using a click-dye reagent or a quartz crystal microbalance (QCM) technique, and the resulting surfaces were well-characterized using XPS, and contact angle measurements. Utilizing this approach two different surfaces have been obtained; that is, triethylenglycol oligomers and amoxicillin molecules were efficiently introduced to the dendritic surface. As a second example, mannose-decorated hydroxyl functional surfaces illustrated their potential as biosensors by multivalent detection of lectin protein at concentration as low as 5 nM.

  • 79.
    Neus, Feliu Torres
    et al.
    Karolinska Inst, Stockholm, Sweden .
    Walter, Marie V.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Montanez, Maria I.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Kunzmann, Andrea
    Karolinska Inst, Stockholm, Sweden .
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Nyström, Andreas
    Karolinska Inst, Stockholm, Sweden .
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Fadeel, Bengt
    Karolinska Inst, Stockholm, Sweden .
    Biocompatibility of polyester dendrimers in comparison to polyamidoamine dendrimers2012Inngår i: Toxicology Letters, ISSN 0378-4274, E-ISSN 1879-3169, Vol. 211, s. S203-S204Artikkel i tidsskrift (Annet vitenskapelig)
  • 80.
    Nilsson, Camilla
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Simpson, Neil
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Johansson, Mats K. G.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malmström, Eva E.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Synthesis and Thiol-Ene Photopolymerization of Allyl Ether Functionalized Dendrimers2008Inngår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 46, nr 4, s. 1339-1348Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Well-defined, allyl-ether functional, first-generation dendrimers have been synthesized. The convergent growth approach was utilized, using the anhydride of the allyl-ether terminated building block. Three different core moieties were used: trimethylolpropane, trisphenol, and ditrimethylolpropane. The coupling reactions proceeded in good yields and all compounds were characterized by NMR, MALDI-TOF, and SEC. The allyl-terminated dendrimers were crosslinked by thiol-ene chemistry, using a multifunctional thiol, TriThiol, to give clear and smooth films. The photopolymerization was conducted in the presence of a photoinitiator, Irgacure 651, and no traces of either allyl-ether groups or thiols were observed by FT-Raman after cure. All crosslinked films were characterized with respect to mechanical (DMA) and thermal (DSC) properties. It was found that homogeneous networks were formed and that the core functionality and structure had little effect on the network properties.

  • 81.
    Nilsson, Camilla
    et al.
    KTH, Skolan för kemivetenskap (CHE).
    Simpson, Neil
    KTH, Skolan för kemivetenskap (CHE).
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE).
    Johansson, Mats
    KTH, Skolan för kemivetenskap (CHE).
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE).
    POLY 664-Polymer networks based on dendrimer monomers2007Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Artikkel i tidsskrift (Annet vitenskapelig)
  • 82.
    Nordberg, Axel
    et al.
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    von Holst, Hans
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Fibre reinforced Thiol-Ene patch fixation of bone fracturesManuskript (preprint) (Annet vitenskapelig)
  • 83.
    Nordberg, Axel
    et al.
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Montanez, Maria I.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    von Holst, Hans
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Highly Adhesive Phenolic Compounds as Interfacial Primers for Bone Fracture Fixations2010Inngår i: ACS APPLIED MATERIALS & INTERFACES, ISSN 1944-8244, Vol. 2, nr 3, s. 654-657Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Bone fractures are today scabilized with screws and metal plates. More complicated Fractures require alternative treatments that exclude harsh surgical conditions. By adapting the benign and UV initiated thiol-ene reaction, we efficiently fabricated triazine-based, fiber-reinforced adhesive patches within 2 s. To enhance their bone adhesion properties, we found that a pre-treatment step of bone surfaces with phenolic dopamine and poly(parahydroxystyrene) compounds was successful. The latter display the greatest E-module of 3.4 MPa in shear strength. All patches exhibited low cytotoxicity and can therefore find potential use in future treatments of bone fractures.

  • 84.
    Nordberg, Axel
    et al.
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Montañez, Maria I.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Ramakrishnan, Subashiyni
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    von Holst, Hans
    KTH, Skolan för teknik och hälsa (STH), Neuronik.
    Higly adhesive DOPA primers for fibre reinforced Thiol-Ene patch fixation of bone fractures.Manuskript (preprint) (Annet vitenskapelig)
  • 85.
    Nordstrom, Randi
    et al.
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Singh, Shalini
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden..
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden.;Univ Copenhagen, Bispebjerg Hosp, Wound Healing Ctr, Dept Biomed Sci, DK-2200 Copenhagen, Denmark..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.;Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark..
    Degradable dendritic nanogels as carriers for antimicrobial peptides2019Inngår i: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 554, s. 592-602Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPS). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40-60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 mu M.

  • 86. Nordström, R.
    et al.
    Nyström, L.
    Andrén, Oliver C. J.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Umerska, A.
    Davoudi, M.
    Schmidtchen, A.
    Malmsten, M.
    Membrane interactions of microgels as carriers of antimicrobial peptides2018Inngår i: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 513, s. 141-150Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use. 

  • 87.
    Nordström, Randi
    et al.
    Ms, Dept Pharm, Uppsala, Sweden..
    Nyström, Lina
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Andrén, Oliver C. J.
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemi, bioteknologi och hälsa (CBH), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Umerska, Anita
    MINT Univ Angers, Angers, France..
    Davoudi, Mina
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Schmidtchen, Artur
    Lund Univ, Dept Clin Sci, Lund, Sweden..
    Malmsten, Martin
    Uppsala Univ, Dept Pharm, Uppsala, Sweden..
    Poly(acrylic acid) microgels as carriers for antimicrobial peptides2018Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Artikkel i tidsskrift (Annet vitenskapelig)
  • 88.
    Nystrom, Daniel
    et al.
    KTH, Skolan för kemivetenskap (CHE).
    Lindqvist, Josefina
    KTH, Skolan för kemivetenskap (CHE).
    Östmark, Emma
    KTH, Skolan för kemivetenskap (CHE).
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE).
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE).
    Johansson, Mats
    KTH, Skolan för kemivetenskap (CHE).
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE).
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE).
    POLY 598-Superhydrophobic biofiber surfaces obtained via ATRP and postfunctionalization reactions2007Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 234Artikkel i tidsskrift (Annet vitenskapelig)
  • 89.
    Nyström, Andreas
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Furo, Istvan
    KTH, Skolan för kemivetenskap (CHE), Kemi.
    Nyström, Daniel
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Unal, Kerem
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Vamvounis, George
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Hawker, Craig
    Wooley, Karen
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik.
    Characterization of Poly(norbornene) Dendronized Polymers Prepared by Ring-Opening Metathesis Polymerization of Dendron Bearing Monomers2006Inngår i: Macromolecules, ISSN 0024-9297, E-ISSN 1520-5835, Vol. 39, nr 21, s. 7241-7249Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The preparation and characterization of a series of first to fourth generation dendronized poly-(norbornene)s are presented. The monomers were synthesized in a divergent fashion from 5-norbornene-2-methanol, utilizing the acetonide protected anhydride of 2,2-bis(methylol)propionic acid. The norbornenyl bearing dendrons were polymerized by ring-opening metathesis polymerization, and it was found that the Grubbs' first generation catalyst resulted in polymers with lower polydispersity compared to the materials obtained when employing the second generation catalyst. Two series of first to fourth generation polymers were characterized by DSC, SEC, and dynamic rheological measurements. In addition, it was found that the fourth generation material could form regular, porous membranes and birefringent fibers. The membranes were characterized with atomic force and optical microscopy. The birefringent fibers were analyzed with X-ray diffraction, polarized FTIR, and polarized optical microscopy.

  • 90.
    Nyström, Andreas
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Dendronized ABA Triblock copolymers by Reversible Addition-Fragmentation Transfer Polymerization2006Manuskript (preprint) (Annet vitenskapelig)
  • 91.
    Nyström, Daniel
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Lindqvist, J.
    Östmark, Emma
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Antoni, Per
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Johansson, Mats
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malmström, Eva
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Superhydrohobic bio-fibre surfaces obtained via ATRP and postfunctioalizations reactions2007Manuskript (preprint) (Annet vitenskapelig)
  • 92.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Andrén, Oliver C. J.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Recent Advances on Crosslinked Dendritic Networks2014Inngår i: Journal of Applied Polymer Science, ISSN 0021-8995, E-ISSN 1097-4628, Vol. 131, nr 3, s. 39876-Artikkel, forskningsoversikt (Fagfellevurdert)
    Abstract [en]

    The branched architectures of dendritic polymers display a large number of end groups, and dendrimers have been extensively evaluated as scaffolds in a large array of research fields, including biomedicine and nanotechnology. From the number of potential applications that require advanced crosslinked films, dendritic macromolecules are attractive as scaffolds that deliver on promising crosslinked three-dimensional (3D) networks. This review briefly covers a description of the family of functional dendritic polymers, ranging from dendrimers and dendrons to hyperbranched polymers and dendritic linear hybrids. The review also contains a detailed report on proposed chemistries for the exploitation of dendritic materials as scaffolds in the field of advanced networks.

  • 93.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Granskog, Viktor
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Cai, Yanling
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Activated dopamine derivatives as primers for adhesive-patch fixation of bone fractures2016Inngår i: RSC Advances, ISSN 2046-2069, E-ISSN 2046-2069, Vol. 6, nr 31, s. 26398-26405Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    For the stabilization of complex bone fractures, tissue adhesives are an attractive alternative to conventional implants, often consisting of metal plates and screws whose fixation may impose additional trauma on the already fractured bone. This study reports on the synthesis and evaluation of activated dopamine derivatives as primers for fiber-reinforced-adhesive patches in bone-fracture stabilization strategies. The performance of synthesized dopamine derivatives are evaluated with regard to the adhesive shear strength of formed bone patches, as well as cell viability and surface properties. Dopamine-derived primers with methacrylamide, allyl, and thiol functional groups were found to significantly increase the adhesive shear strength of adhesive patches. Furthermore, deprotonation of the primer solution was determined to be essential in order to achieve good adhesion. In conclusion, the primer solutions that were found to give the best adhesion were the once where dopa-thiol was used in combination with either dopamethacrylamide or dopa-allyl, resulting in shear bond strengths of 0.29 MPa.

  • 94.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Granskog, Viktor
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Cai, Yanling
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Activated Dopamine Derivatives as Promising Primers for Adhesive-Patch Fixation of Bone FracturesManuskript (preprint) (Annet vitenskapelig)
  • 95.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Facile Synthesis of Dopa-Functional Polycarbonates viaThiol-Ene-Coupling Chemistry towards Self-Healing Gels2016Inngår i: Journal of Polymer Science Part A: Polymer Chemistry, ISSN 0887-624X, E-ISSN 1099-0518, Vol. 54, nr 15, s. 2370-2378Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Since extraction of the naturally occurring mussel-foot proteins is expensive and time-consuming, routes towards synthetic analogues are continuously being explored. Often, these methods involve several protection and deprotection steps, making the synthesis of synthetic analogues time-consuming and expensive as well. Herein, we show that UV-initiated thiol-ene coupling between a thiol-functional dopamine derivative and an allyl-functional aliphatic polycarbonate can be used as a fast and facile route to dopa-functional materials. Different thiol-to-allyl ratios and irradiation protocols were used and it was found that nearly 50% of the allyl groups could be functionalized with dopa within short reaction times, without the need of protecting the catechol. It is also demonstrated herein that the dopa-functional polymers can be used to form self-healing gels through complexation with Fe3+ ions at increased pH.

  • 96.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    PEG-based hydrogels with well-defined network structures via UV-induced thiol-ene coupling: Synthesis and characterization2014Inngår i: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 248Artikkel i tidsskrift (Annet vitenskapelig)
  • 97.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknik, Ytbehandlingsteknik.
    Soft hydrogels from tetra-functional PEGs using UV-induced thiol-ene coupling chemistry: a structure-to-property study2014Inngår i: RSC Advances, ISSN 2046-2069, E-ISSN 2046-2069, Vol. 4, nr 57, s. 30118-30128Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    In this work, photo-induced thiol-ene coupling (TEC) was used to produce well-defined poly(ethylene glycol) (PEG)-based hydrogels. PEGs of four different molecular weights (2k, 6k, 10k, and 20k) were functionalized with G1-allyl dendrons using anhydride chemistry to produce tetra-functional TEC crosslinkable PEGs. The tetra-functional PEGs were subsequently crosslinked with a tri-functional thiol in ethanol to form hydrogels. The synthesized hydrogels were characterized with respect to swelling behaviour, rheological properties and hydrolytic degradation. It was found that the molecular weight of the PEG chain greatly influences the final properties of the hydrogel, where a higher molecular weight of PEG gives an increased weight swelling ratio from 240% for PEG-2k hydrogels to 1400% for PEG-20k hydrogels, as well as decreased elastic moduli, with Young's moduli ranging from 106 MPa to 6 MPa, for PEG-2k and PEG-20k hydrogels, respectively. It was also found that the hydrolytic stability in alkaline conditions (pH 10) decreased when the molecular weight of PEG in the hydrogels increased.

  • 98.
    Olofsson, Kristina
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Zhang, Yuning
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Anders
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Dopa-Functionalized PEG-based Triblock-co-Polymers as Micelles towards Drug-Delivery ApplicationsManuskript (preprint) (Annet vitenskapelig)
  • 99.
    Olsson, J. V.
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Daniel
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Garcia-Gallego, Sandra
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Fluoride-promoted carbonylation polymerization: A facile step-growth technique to polycarbonates2017Inngår i: Chemical Science, ISSN 2041-6520, E-ISSN 2041-6539, Vol. 8, nr 7, s. 4853-4857Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Fluoride-Promoted Carbonylation (FPC) polymerization is herein presented as a novel catalytic polymerization methodology that complements ROP and unlocks a greater synthetic window to advanced polycarbonates. The overall two-step strategy is facile, robust and capitalizes on the synthesis and step-growth polymerization of bis-carbonylimidazolide and diol monomers of 1,3- or higher configurations. Cesium fluoride (CsF) is identified as an efficient catalyst and the bis-carbonylimidazolide monomers are synthesized as bench-stable white solids, easily obtained on 50-100 g scales from their parent diols using cheap commercial 1,1′-carbonyldiimidazole (CDI) as activating reagent. The FPC polymerization works well in both solution and bulk, does not require any stoichiometric additives or complex settings and produces only imidazole as a relatively low-toxicity by-product. As a proof-of-concept using only four diol building-blocks, FPC methodology enabled the synthesis of a unique library of polycarbonates covering (i) rigid, flexible and reactive PC backbones, (ii) molecular weights 5-20 kg mol-1, (iii) dispersities of 1.3-2.9 and (iv) a wide span of glass transition temperatures, from -45 up to 169 °C.

  • 100.
    Olsson, Johan V.
    et al.
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Hult, Daniel
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Cai, Yanling
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Garcia-Gallego, Sandra
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi.
    Malkoch, Michael
    KTH, Skolan för kemivetenskap (CHE), Fiber- och polymerteknologi, Ytbehandlingsteknik.
    Reactive imidazole intermediates: simplified synthetic approach to functional aliphatic cyclic carbonates2014Inngår i: Polymer Chemistry, ISSN 1759-9954, E-ISSN 1759-9962, Vol. 5, nr 23, s. 6651-6655Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Reactive imidazole intermediates based on AB(2) and A(3) monomers, i.e. bis(methylol) propionic acid (bis-MPA) and trimethylolpropane (TMP) have successfully been synthesized and isolated on a 100 gram scale via a facile synthetic protocol using 1,1' -carbonyldiimidazole (CDI) as a key reagent. The robustness of the imidazole intermediates as bench stable precursors enabled the synthesis of a library of functional cyclic carbonates bearing relevant functionalities including hydrophilic PEGs, bioactive cholesterol and clickable groups. A number of functional polycarbonates were obtained by ring-opening polymerization, and their relevance in biomedical applications was highlighted by their low cytotoxicity on human dermal fibroblasts (hDF).

123 51 - 100 of 128
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • harvard1
  • ieee
  • modern-language-association-8th-edition
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf